Details for Kale Locus Bo5g120030

Position : C5 ( 5`- 36605619 .. 36607245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120030

Protein [Map View]
MGKITLGSHTVKSHGWKVAREHLIDWIILVLLGIVIIVLNIMEPFHRYIGPDMLTDLTFPLYQDTIPIWAVPIICILVPI
CIFTVYYYFGRDVYDLHHAILGIGFSCLVTGVTTDSIKNAVGRPRPNFFHRCFPDGKAKFDSVTKDVVCHGVKKIIKEGY
KSFPSGHTSWSFAGLTFLAWYLSGKIKVFDRRGHVAKLCLVFLPILVAVLIGITRVDDYWHHWTDVFAGAIIGIFFSSLS
YLHFFPYPYDDNGWAPHAYFRMLAESSRRDTTMTRSGSREMLENDVELGSSSMPHHRNRGSTDSE*

DNA
ATGGGTAAGATAACGCTTGGATCTCACACGGTAAAGAGCCATGGATGGAAAGTGGCTCGAGAGCATCTAATTGACTGGAT
CATCCTCGTCCTCCTCGGTATTGTCATCATTGTTCTCAACATTATGGAGCCATTTCATCGCTACATCGGGCCAGACATGT
TGACCGATCTAACTTTCCCATTGTATCAAGACACCATCCCTATTTGGGCTGTCCCGATTATTTGTATATTGGTTCCGATA
TGCATCTTCACAGTGTACTATTACTTTGGAAGAGATGTTTATGATCTTCATCACGCCATTCTCGGTATTGGATTCTCATG
TCTTGTGACTGGAGTCACCACTGATTCCATCAAAAATGCGGTCGGTAGGCCACGACCTAACTTCTTCCACCGATGTTTTC
CCGATGGTAAAGCGAAATTTGATTCGGTTACTAAGGATGTTGTGTGCCATGGAGTTAAAAAAATCATCAAAGAAGGTTAC
AAGAGTTTTCCTAGCGGTCACACTTCCTGGTCCTTCGCCGGTTTAACTTTCCTTGCATGGTACTTATCGGGGAAGATCAA
AGTCTTTGACAGAAGAGGACACGTGGCAAAGCTATGCCTTGTGTTCTTACCAATACTCGTCGCAGTTCTCATCGGAATAA
CACGCGTCGACGACTATTGGCATCATTGGACCGACGTCTTCGCCGGTGCGATCATCGGAATATTTTTCTCATCTTTATCT
TACCTCCACTTTTTCCCTTACCCATACGACGACAATGGATGGGCACCACATGCGTATTTTAGAATGTTGGCCGAGAGTAG
TCGTCGTGACACAACGATGACTCGGAGCGGTTCACGAGAGATGTTGGAAAACGACGTTGAGCTTGGCTCTAGCTCCATGC
CGCACCATCGTAATCGAGGAAGCACTGATTCTGAATGA