Details for Kale Locus Bo5g120020

Position : C5 ( 5`- 36597902 .. 36600148 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g120020

Protein [Map View]
METPLSSIPQLVPNLTSATMVDGSPRAIALDTELLASVPDTKLRLMCSFGGHIMPRPHDMALTYSSGETRLVVVDRRSSL
ASLRSRLSSMLLNGRSFTLKYQLPNEDLDSLVTITTDEDLENMIEEYDRATSSATTSATHRIRLFLFANKLETAATMGSL
LNSAKSETWFVDALNQSGLLPRGLSDSAAVNNTLVNLDEGTGGETEVQELETDVDGENNKRGDYITNDVMSHQEMHMSSM
PDSPMLEPTGGSSSSSPSNANLPPIHVRVSEEQFAHQPMMGYNNAPIDNVTAVRNGQASSDDDRSDPSVMVGYKKPPLPM
QPLLIPLRGAGGYSLASPDSIASDTSISSATSFPKPMYYQDQPPAIPKAPITHPETTLVQTSHGIPLHETTSVQTTSDVI
SQSGTYTTMDQQHQLQVQQPLLHQGVQYIPHPSQYIPVYSHQQQNYPVYVMSVPQSQQYVPSRTPPLCPNARPEAGQNVY
QAVISQNPQVHQIQQQQLQQPQHQYMSYSGGPLETMYFHAQHPPVSNAIPLVSPYQSMTPAAAAAALADMSKQMTLDNDK
EQQHIAASQPL*

DNA
ATGGAGACTCCACTTTCATCTATACCGCAACTAGTCCCAAACCTCACTTCAGCTACAATGGTTGATGGGTCCCCACGTGC
TATTGCTCTTGATACGGAACTACTTGCGTCCGTCCCAGACACTAAGCTTCGCCTCATGTGCAGCTTTGGCGGCCACATCA
TGCCTCGTCCACACGACATGGCCCTAACGTACTCCAGCGGCGAGACACGTCTAGTTGTTGTTGATCGACGCTCTTCACTA
GCCTCGCTCAGATCTCGTCTCTCTAGTATGCTTCTCAACGGCCGGTCCTTCACACTCAAGTACCAGCTCCCTAACGAAGA
TCTTGATTCTCTTGTAACCATCACTACCGATGAAGATCTTGAGAACATGATCGAGGAATACGACCGCGCGACGTCATCAG
CAACGACGAGTGCAACGCATCGGATACGGTTGTTCCTTTTTGCTAACAAGCTTGAGACGGCTGCTACGATGGGATCTTTG
CTTAACAGTGCAAAGTCGGAGACGTGGTTCGTTGATGCTTTGAATCAATCTGGTTTGCTTCCTCGTGGTTTGTCGGATTC
TGCCGCTGTGAACAACACCTTGGTGAATCTTGATGAGGGGACCGGAGGAGAGACCGAAGTTCAAGAACTAGAAACTGATG
TGGACGGTGAGAACAACAAGCGAGGAGATTATATCACAAACGATGTGATGTCTCATCAGGAGATGCATATGAGTTCGATG
CCTGATTCACCTATGTTGGAACCCACCGGTGGTTCTTCCTCTTCCTCTCCTTCCAATGCTAACTTACCACCGATCCACGT
TAGAGTCAGCGAAGAACAGTTTGCTCATCAACCAATGATGGGTTATAACAATGCACCGATTGATAATGTCACTGCCGTAA
GAAATGGTCAGGCTTCATCGGATGACGATCGATCAGATCCTAGTGTGATGGTTGGATACAAAAAGCCACCGTTGCCGATG
CAACCATTGCTGATCCCTCTCAGGGGTGCCGGTGGGTATAGCTTGGCATCTCCTGATTCTATTGCAAGTGATACTAGCAT
TTCTTCTGCTACTTCATTTCCGAAGCCGATGTACTACCAAGACCAACCTCCAGCCATCCCAAAAGCCCCGATAACACATC
CTGAAACAACATTGGTCCAAACCAGTCACGGCATACCTCTGCATGAAACCACTTCAGTCCAAACCACATCAGATGTCATA
TCCCAGTCAGGTACATACACAACTATGGACCAACAACACCAACTCCAGGTTCAACAACCTCTCTTACACCAAGGTGTTCA
GTACATCCCTCATCCATCACAATACATCCCGGTCTACTCTCACCAGCAGCAAAACTATCCGGTTTACGTAATGTCCGTCC
CGCAATCTCAACAATACGTCCCATCAAGAACTCCTCCGCTCTGCCCAAACGCAAGACCTGAAGCCGGTCAAAACGTTTAC
CAAGCTGTTATATCGCAAAACCCTCAGGTTCATCAGATTCAGCAACAGCAATTGCAACAGCCTCAACATCAATACATGAG
TTACTCTGGAGGTCCTCTGGAGACGATGTATTTCCATGCACAACATCCTCCTGTTAGCAATGCTATTCCATTGGTTTCTC
CGTACCAAAGCATGACACCTGCGGCAGCCGCAGCCGCTCTAGCTGATATGTCCAAGCAGATGACTCTGGATAACGACAAA
GAACAACAACATATTGCTGCGTCTCAACCGCTTTAA