Details for Kale Locus Bo5g119980

Position : C5 ( 5`- 36589470 .. 36591610 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g119980

Protein [Map View]
MRGALFRNASLCARRLLLSPRINTHQPSSSSNARFVAPIATPFPPRLFSSESDSSGENPPPPPESSSPIESSNKKDLAVE
DVGNKELKARIEKYFNEGNEDALPGIIEALLQRRLADKHADTDDEVMDSLQNQPFKDDVKDEDFESDFEEAHSTDDELED
LYNSPEYVKKKMQNNEFFNMDEKKWDVIVRDGIRHGILKDTKECEEILEDMLHWDKLLPDDLKKKVEAKFNELGDMCERG
EIEPEAAYELFKEFEDEMVIQYGDQMEAAGPPKFDETDPSYSNTNLDDPPGKGPILRWQSRIVFAPGGDAWHPKNRKVKL
SVTVKELGLSKHQARRLRELVGKRYDSGKDELTITSERFEHREENRKDCLRTLYGLIEEAAKANKIAEDIRTAYVKQRLQ
ANPAFMQKLQAKIMRSKESNPINA*

DNA
ATGAGAGGAGCTCTCTTCAGAAATGCATCTCTCTGCGCTCGCAGACTTCTCCTTTCTCCTCGAATCAACACTCATCAACC
CTCCTCCTCCTCCAATGCTCGTTTCGTCGCTCCGATCGCCACTCCGTTTCCCCCCAGATTATTCTCCTCCGAATCCGATT
CCTCCGGCGAGAACCCTCCTCCTCCTCCGGAGTCTTCTTCTCCGATTGAATCCTCCAACAAGAAAGATCTCGCTGTAGAA
GACGTAGGAAACAAAGAGCTTAAGGCCCGTATAGAGAAGTACTTCAACGAAGGAAACGAAGACGCTTTACCCGGAATCAT
CGAAGCTCTTCTCCAGAGAAGGCTTGCTGACAAGCACGCGGACACGGATGACGAAGTGATGGACTCGCTCCAGAACCAGC
CTTTCAAAGACGATGTGAAAGACGAAGACTTTGAATCTGATTTCGAGGAAGCTCACTCTACTGACGACGAGCTCGAGGAT
CTGTATAATTCCCCTGAGTATGTGAAGAAGAAGATGCAGAACAATGAGTTCTTTAATATGGATGAGAAGAAGTGGGATGT
CATTGTTAGAGATGGGATTAGGCATGGGATTTTGAAGGATACTAAGGAGTGTGAAGAGATTCTTGAGGATATGCTTCACT
GGGACAAGCTTCTTCCTGATGACTTGAAGAAGAAAGTTGAAGCGAAGTTTAATGAGCTCGGAGACATGTGTGAAAGGGGT
GAAATCGAGCCTGAAGCAGCTTATGAGCTGTTTAAGGAATTCGAAGATGAGATGGTGATTCAATATGGGGATCAAATGGA
AGCTGCGGGACCTCCCAAGTTTGATGAAACGGATCCTTCCTATAGCAACACCAACTTGGATGACCCTCCCGGTAAAGGTC
CAATCCTTAGGTGGCAGTCAAGGATTGTTTTTGCTCCTGGAGGCGATGCTTGGCATCCAAAGAACAGGAAAGTTAAACTG
TCTGTTACAGTGAAAGAGCTCGGACTCTCTAAGCATCAGGCTCGTAGGCTACGGGAGCTCGTTGGAAAAAGATATGATTC
AGGGAAAGACGAGCTTACAATCACAAGCGAGAGGTTTGAACACCGAGAGGAAAACAGGAAAGACTGCTTGCGGACGCTAT
ACGGGTTGATAGAGGAAGCTGCGAAGGCTAACAAGATTGCTGAGGACATAAGAACTGCTTATGTGAAACAGAGGCTCCAA
GCTAATCCAGCTTTTATGCAGAAACTACAAGCCAAGATCATGAGGTCTAAAGAATCAAATCCCATCAACGCATAA