Details for Kale Locus Bo5g119970

Position : C5 ( 5`- 36588766 .. 36588993 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g119970

Protein [Map View]
MARHLEDVISMATTTTQFHVSYLLHIVFLALFSCCVLSALLLSCADGASENKATSGNTPSAGGCGGAGCGGGCGD*

DNA
ATGGCGAGACATTTAGAAGATGTGATTAGCATGGCGACAACAACAACACAGTTCCATGTTAGTTACCTTCTTCATATTGT
GTTTTTGGCTCTGTTCAGCTGTTGTGTCCTCTCGGCTCTGTTACTCTCATGTGCTGACGGAGCATCCGAGAACAAAGCCA
CTTCCGGCAATACCCCTTCTGCCGGTGGTTGTGGTGGTGCCGGTTGCGGCGGTGGTTGTGGAGATTGA