Details for Kale Locus Bo5g118910

Position : C5 ( 5`- 36560892 .. 36562655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118910

Protein [Map View]
MFSMATSSSSQLVNFRNSPKSLIPVMSAASGFKTLTENFTVRIQRAENRELNVPLLSPFTIASSRLDSVGNVAIRIELSG
GCVGWGEAPILPSVTAEDQPTAMAKAREACELLRELPEMKLGHVLEEIGGILPGHRFASVRAGVEMAMIDAAAKSVGVPL
WKLFGGASNSITTDITIPIVSPAEASNLAAKYREEGFKTLKLKVGKNLKADIQVLQAIREVHPASSFILDANEGYKTEEA
IEVLQKLYEMKVTPVLFEQPVHRDNWEGLRHVTRVAKDRFGVSVAADESCRDLTDLQRIIKDDVVDVVNIKLAKSGVLEA
LEVIELARSSGIELMIGGMVETRLAMGFSGHLAAGIGCFRFIDLDTPLLLAGDPVQGGYKASGAVYEFNDEGGHGGYLY*

DNA
ATGTTTTCGATGGCAACTTCTTCGTCTTCCCAACTCGTCAATTTTCGAAATTCTCCGAAATCCCTTATCCCCGTCATGTC
AGCTGCGTCTGGGTTCAAAACCCTGACGGAGAATTTCACGGTGAGGATTCAGAGAGCAGAGAACCGCGAACTGAACGTCC
CCCTGCTCTCCCCCTTCACCATCGCTTCGTCCCGCCTCGATTCCGTCGGAAACGTCGCGATTCGGATCGAGCTCAGCGGC
GGATGCGTCGGCTGGGGAGAAGCTCCGATTTTACCCTCGGTGACGGCGGAGGATCAGCCTACAGCCATGGCTAAAGCGCG
GGAAGCTTGCGAGCTTCTCAGAGAGTTGCCGGAGATGAAGCTGGGTCACGTTCTTGAGGAGATCGGCGGGATTCTCCCTG
GGCATCGATTTGCATCTGTAAGAGCGGGGGTGGAGATGGCTATGATTGATGCTGCTGCTAAGAGCGTTGGAGTTCCCTTG
TGGAAACTCTTTGGTGGTGCTTCGAATTCAATCACCACCGATATTACAATTCCGATAGTTTCTCCAGCTGAAGCTTCAAA
CTTGGCTGCAAAGTACAGAGAAGAAGGGTTTAAAACCTTGAAGCTCAAGGTTGGGAAGAACCTTAAGGCTGATATACAAG
TTCTCCAGGCTATACGTGAAGTCCACCCTGCTTCTTCCTTCATTTTGGACGCAAACGAGGGTTATAAAACAGAGGAAGCT
ATCGAAGTTCTCCAAAAGCTTTATGAAATGAAGGTTACACCGGTTCTCTTTGAACAACCAGTCCACAGAGACAATTGGGA
AGGTCTCAGACACGTTACTCGAGTTGCAAAGGACAGATTTGGAGTCTCGGTTGCAGCAGACGAGAGTTGTAGAGACTTGA
CTGATCTCCAGAGAATCATTAAAGATGATGTGGTAGATGTTGTTAACATCAAACTCGCCAAATCCGGTGTTCTCGAGGCC
CTTGAGGTGATTGAATTGGCTAGATCGTCTGGAATTGAGCTTATGATAGGGGGAATGGTGGAGACTAGACTAGCAATGGG
GTTCTCCGGTCACCTTGCTGCTGGCATTGGGTGTTTCAGATTCATCGACTTAGACACTCCACTTCTTCTAGCTGGTGATC
CCGTTCAAGGTGGCTACAAAGCATCGGGTGCTGTCTATGAGTTTAATGATGAAGGCGGTCACGGAGGATATCTTTACTGA