Details for Kale Locus Bo5g118870

Position : C5 ( 5`- 36527634 .. 36533128 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118870

Protein [Map View]
MATPLPDFEAARGGGGVASSSTTVLTSAPTVANTFTEEAEEISPILIFLFFHKAVCSELESLHRLALEFATGHHVDLRLL
RERYRFLRSIYKHHCNAEDEVIFSALDIRVKNVAQTYSLEHQGEGTLFDHLFELLNSATEIDESYRRELASSTGALKTSV
SQHLAKEQKQVFPLLIEKFKHEEQAYIVWRFLCSIPVNMLAVFLPWLASANSIDESKEKQMCLSKIVPGEKLLQQVIFTW
FGGKSDTSASRGVEDSSFQCCLDSSSSMLPCKTSRAQCACEGSKAGKRKYPELTEYEAPDAPMHPIDEIKIWHKSINKEM
KEIADEARKIQLSGDFSDLSAFDERLQYIAEVCIFHSLAEDKIIFPAVDGEFSFSEEHDEEENQFNEFRCLIEKIKSAGA
SSTSAAEFYTKLCSHADQIMETIQRHFHNEEIQVLPLARKNFSFKRQQEILYQSLCIMPLRLIERVLPWLTASLTEDEAK
NFLKNLQAGAPKSDAALVTLFSGWACKGRKAGECLSPKANGSCPAKTLSNIEEVYLQSCNACVSLPCPSSSIKACCQHQD
KRPAKRTVVSSCGQNATPHSSEVANGNGRSCCVPDLGVNSDCLGLGSLPAAKSMRSSSLNSAAPALNSSLFGWEMDSNSF
DTGHAERPVATIFKFHKAISKDLEFLDVESGKLIDCNETFIHQFIGRFHLLWGFYKAHSNAEDDILFPALESKETLHNVS
HSYTLDHKHEEKLFGDIYSVLTELSVLHEKLQSDSMMGNVTQTDTVQADIDSGDCKKKYNELATKLQGMCKSIKITLDQH
IFLEELELWPLFDKHFSIQEQDKIVGRIIGTTGAEVLQSMLPWVTSALSEDEQNRMMDTWKQATKNTMFDEWLNECWKGS
PDLSSMERAKPSLHRDNDHQEVLDQTGQLFKPGWKDIFRMNQNELEAEIRKVYQDTTLDPRRKDYLVQNWRTSRWIAAQQ
KLPKETETALNGDVALGCFPSFRDPEKQIYGCEHYKRNCKLRAACCGQLFTCRFCHDKVSDHSMDRKLVTEMLCMRCLKV
QPVGPICTTPSCEGVPMAKHYCSICKLFDDERAVYHCPFCNLCRVGEGLGIDYFHCMTCNCCLGMKLVNHKCLEKSLETN
CPICCEFLFTSSEAVRALPCGHYMHSACFQAYTCSHYTCPICGKSLGDMAVYFGMLDALLAAEELPEEYKDRCQDILCND
CERKGTTRFHWLYHKCGTCGSYNTRVIRSETTTVPDCSTSS*

DNA
ATGGCGACGCCGTTGCCGGATTTTGAGGCGGCGAGAGGTGGCGGAGGAGTCGCTTCTTCATCAACAACGGTGCTCACGAG
CGCTCCTACTGTGGCGAATACGTTCACGGAGGAGGCGGAAGAGATATCTCCGATCCTGATTTTCCTCTTCTTTCATAAGG
CGGTATGCAGTGAGCTCGAATCGCTTCATAGGCTGGCGCTTGAGTTTGCTACAGGTCACCACGTTGATCTCCGTCTCCTC
CGTGAACGGTACCGGTTCCTTAGATCCATCTATAAGCATCACTGCAATGCCGAGGACGAGGTGATCTTTTCAGCTCTTGA
CATACGCGTGAAGAACGTAGCGCAGACGTATTCTCTTGAGCACCAAGGTGAAGGCACCCTCTTCGACCATCTGTTTGAGC
TGCTAAATTCCGCCACGGAGATCGATGAAAGTTATCGGAGGGAATTGGCGAGCAGTACTGGAGCACTTAAGACATCTGTT
AGCCAGCACTTGGCTAAAGAACAGAAACAGGTGTTCCCGTTACTTATTGAGAAATTTAAGCACGAGGAGCAAGCTTACAT
AGTCTGGAGGTTTCTCTGCAGCATTCCTGTGAATATGCTTGCCGTGTTTCTTCCGTGGCTGGCTTCAGCCAATTCAATAG
ATGAAAGCAAGGAGAAGCAGATGTGCTTAAGCAAGATAGTTCCTGGCGAGAAGCTCCTTCAGCAGGTTATTTTCACCTGG
TTCGGAGGGAAAAGCGATACTTCTGCTTCGCGTGGTGTAGAGGATTCTTCGTTCCAGTGTTGTCTAGATTCTTCTAGCAG
CATGCTTCCGTGCAAAACTAGTAGAGCCCAGTGCGCATGTGAGGGATCCAAGGCCGGGAAGAGAAAGTATCCAGAGCTTA
CCGAGTATGAAGCTCCTGATGCTCCTATGCACCCAATTGATGAGATAAAAATTTGGCACAAGTCAATCAACAAGGAGATG
AAGGAAATAGCTGATGAGGCTAGGAAAATTCAGCTGTCTGGAGATTTTTCGGATTTATCTGCATTTGATGAACGCTTGCA
GTATATTGCTGAAGTATGCATCTTTCACAGTCTTGCAGAGGACAAGATCATATTTCCAGCAGTAGATGGGGAGTTTTCAT
TTTCCGAGGAGCACGATGAAGAAGAAAACCAGTTTAACGAGTTCCGGTGCTTAATTGAAAAAATCAAAAGTGCTGGAGCC
TCTTCTACTTCTGCTGCTGAATTTTACACCAAGCTGTGCTCACATGCGGATCAAATAATGGAAACTATTCAAAGGCACTT
TCACAACGAGGAAATTCAGGTGCTGCCCCTTGCACGAAAGAACTTCAGCTTTAAAAGACAACAAGAGATTCTCTACCAAA
GCCTGTGCATAATGCCCTTAAGATTAATTGAACGTGTTTTGCCATGGTTGACTGCATCTTTAACAGAAGATGAAGCAAAG
AATTTTCTGAAGAATTTGCAAGCTGGAGCACCTAAATCGGATGCTGCTCTCGTTACTCTTTTCTCTGGTTGGGCATGCAA
AGGACGCAAAGCGGGGGAATGCTTGTCTCCAAAGGCAAATGGTTCATGCCCTGCTAAAACACTAAGCAACATCGAAGAAG
TCTACCTTCAGTCATGTAATGCTTGTGTGTCTTTGCCATGCCCGAGTAGCAGTATAAAAGCGTGTTGCCAGCATCAGGAT
AAAAGGCCAGCTAAGCGAACTGTTGTGTCGTCTTGTGGACAAAATGCCACCCCTCACTCTTCAGAAGTCGCAAATGGTAA
TGGCAGGTCATGCTGTGTTCCGGATCTCGGAGTTAACAGTGATTGTCTGGGACTTGGTTCCCTTCCAGCAGCTAAATCTA
TGAGATCTTCTTCGCTAAACTCTGCTGCGCCCGCTCTTAATTCTAGCCTCTTTGGTTGGGAAATGGATAGCAACAGCTTT
GATACTGGACATGCCGAGAGGCCAGTTGCTACAATTTTCAAGTTTCACAAGGCCATTAGCAAAGATCTGGAGTTTCTTGA
TGTTGAATCTGGAAAGCTCATTGATTGCAATGAAACGTTTATTCATCAGTTCATCGGTCGCTTTCACCTACTCTGGGGCT
TCTACAAGGCTCATAGTAATGCGGAAGATGATATCCTATTTCCAGCTTTGGAATCGAAGGAGACGCTTCACAATGTCAGC
CACTCTTACACGCTCGACCATAAACATGAGGAGAAGTTGTTTGGAGATATTTACAGTGTTCTTACTGAACTTTCAGTTCT
TCATGAGAAGTTACAGAGTGATTCTATGATGGGGAACGTAACTCAAACGGACACTGTTCAGGCTGATATTGATAGCGGTG
ACTGCAAGAAGAAGTACAACGAACTGGCTACAAAGCTACAAGGGATGTGCAAATCCATTAAGATCACACTGGATCAACAT
ATATTCTTGGAGGAACTGGAGCTCTGGCCTCTATTTGACAAACACTTCTCCATTCAAGAGCAAGACAAGATTGTGGGTCG
TATAATCGGGACGACGGGTGCTGAAGTTCTTCAATCCATGTTACCATGGGTGACATCCGCACTTTCTGAAGATGAGCAAA
ATAGAATGATGGATACATGGAAGCAGGCGACCAAGAACACGATGTTTGATGAATGGCTCAACGAATGCTGGAAAGGATCA
CCCGACTTATCCTCAATGGAAAGAGCCAAACCTAGTCTACACAGAGATAATGATCATCAAGAAGTCTTGGACCAAACTGG
TCAACTTTTTAAGCCGGGTTGGAAAGATATTTTCCGCATGAATCAGAACGAACTAGAGGCTGAAATCAGGAAGGTTTATC
AGGACACAACACTTGATCCAAGGAGAAAAGATTATCTAGTACAAAATTGGAGGACCAGTCGATGGATAGCGGCTCAGCAA
AAGTTACCCAAGGAAACAGAAACTGCGTTAAATGGTGATGTTGCACTTGGATGTTTCCCGTCTTTTAGAGATCCCGAGAA
ACAGATATATGGATGCGAGCATTACAAGCGTAACTGCAAGCTTCGGGCTGCTTGTTGTGGTCAGTTGTTCACTTGTAGGT
TTTGCCATGACAAAGTAAGCGACCACTCAATGGATAGAAAATTGGTGACGGAAATGCTCTGCATGCGATGCCTCAAGGTG
CAACCTGTTGGCCCCATTTGCACAACGCCTTCGTGCGAAGGAGTTCCTATGGCAAAGCACTATTGCAGCATTTGCAAACT
TTTCGATGATGAAAGAGCTGTTTACCACTGTCCATTCTGCAACCTTTGCCGGGTGGGTGAGGGACTAGGAATCGATTATT
TCCATTGCATGACATGTAACTGTTGCCTGGGGATGAAGTTAGTAAACCACAAGTGCCTGGAGAAAAGCCTCGAGACAAAT
TGCCCCATATGCTGTGAATTTCTTTTCACTTCGAGTGAAGCAGTCAGAGCATTACCATGTGGTCACTACATGCACTCAGC
TTGCTTCCAGGCTTACACTTGCAGCCACTACACATGTCCTATCTGTGGAAAATCATTAGGAGATATGGCTGTTTATTTTG
GTATGCTTGATGCACTTTTGGCTGCAGAAGAGCTTCCAGAAGAATACAAAGATCGCTGTCAGGACATTTTATGTAATGAC
TGTGAACGCAAAGGAACGACACGGTTTCATTGGTTGTACCATAAATGCGGCACCTGCGGTTCTTACAACACCCGTGTGAT
CAGATCAGAAACAACAACCGTCCCAGACTGCTCAACCTCATCCTGA