Details for Kale Locus Bo5g118860

Position : C5 ( 5`- 36523298 .. 36525896 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118860

Protein [Map View]
MEFPPPPPPERSKRLHNFTLPYLRWGQQRFLRCVKLPSSSSSSPSPDRANHGSPSLPGAGGGGESAQPKVSALGNGDAAA
ARPWNLRTRRAACNEPGGGDEPTTTTTTRMIITNEIGGVKRGGGDGSEKLKFSVCLLREEIEEDFTALIGKKPPRRPKKR
PRLVQKQMNVLYYKLPSFFFMVLDQASYNNISPCPKFQTASFLSAKRTIMIFAESSHQRISFAGDLGQSDKALTIEQQPS
GLVRRDTTLLDSDFEFHTSRSFDSSPADEIFADGMILPFQATSSMLKRRYKYELPPIVSSIPPPPPPPLPLPSPQQSRKY
CQKETPVVETSSKSFWSFSRSSSLNCDIKKSLICSFPRLTRSISTGSVMNSKRAMLRDVDKHSSLRHGGAPRPQPDPSSC
PPSSCCSSYQFRPQKQSGKNSCSSRGGSFRITPVIGGPSPSGLGSILRLSKDKKTKNTK*

DNA
ATGGAGTTCCCTCCCCCGCCTCCACCGGAGAGATCAAAGCGCCTCCACAACTTCACCTTACCTTATCTCCGATGGGGTCA
GCAGAGATTCCTCAGGTGCGTCAAGCTACCTTCTTCCTCCTCCTCCTCTCCTTCTCCCGATCGCGCCAATCACGGATCTC
CCTCTCTTCCCGGAGCTGGAGGAGGAGGAGAGTCTGCTCAGCCAAAGGTCTCAGCTTTGGGGAATGGAGATGCAGCAGCA
GCTAGGCCGTGGAATCTGAGGACGAGGAGAGCTGCTTGTAACGAGCCTGGTGGAGGAGACGAGCCCACCACCACCACCAC
GACGAGGATGATCATCACAAATGAAATTGGCGGAGTCAAGAGAGGAGGTGGTGATGGATCGGAGAAACTGAAATTCTCTG
TTTGTTTGTTGAGAGAAGAGATCGAAGAGGATTTCACAGCGTTGATTGGTAAAAAGCCTCCTCGTAGACCAAAGAAGAGA
CCCAGACTTGTTCAGAAGCAAATGAATGTACTTTATTATAAACTTCCCTCCTTTTTCTTCATGGTTTTAGACCAAGCTTC
CTATAACAACATCTCACCATGTCCAAAGTTTCAGACAGCTTCCTTTCTCTCTGCAAAACGGACCATTATGATCTTTGCGG
AGTCAAGTCACCAGCGGATATCGTTCGCGGGCGATCTCGGCCAATCAGATAAAGCACTTACGATTGAACAACAACCATCA
GGGCTGGTTCGAAGAGACACAACACTTTTAGATTCAGATTTCGAGTTCCACACTTCAAGAAGCTTTGATTCCTCACCAGC
TGATGAGATCTTCGCTGATGGGATGATCCTTCCTTTCCAAGCAACATCCTCCATGCTAAAACGTCGTTACAAGTACGAGC
TCCCTCCTATCGTCTCCTCTATTCCTCCTCCTCCTCCTCCTCCTCTGCCATTGCCATCACCGCAACAGTCGAGAAAATAC
TGCCAGAAGGAGACTCCAGTGGTAGAAACATCATCAAAGTCGTTTTGGAGCTTCAGTAGAAGCTCGAGCCTTAACTGCGA
TATAAAGAAGAGTCTGATCTGTTCCTTTCCTCGTTTGACAAGAAGCATTTCCACAGGATCAGTGATGAATTCTAAGAGAG
CAATGCTTAGGGACGTTGACAAGCATAGCTCGCTGAGACATGGAGGAGCCCCACGTCCACAGCCAGATCCTTCATCTTGT
CCTCCCTCTTCCTGCTGCAGCTCGTATCAGTTCAGGCCACAAAAGCAATCCGGAAAGAACAGCTGCAGCAGCAGAGGAGG
AAGCTTTCGGATTACTCCAGTGATAGGTGGTCCATCTCCGTCTGGATTAGGATCTATCTTACGACTTTCGAAAGATAAGA
AGACCAAGAACACTAAGTAG