Details for Kale Locus Bo5g118780

Position : C5 ( 5`- 36450787 .. 36452495 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118780

Protein [Map View]
MPRPTFPDHLGLVVVSVSGDDIRVMGLDKGEVFVAKERFFSRVLKILVQPSGDLRVHNELGYVMSRGRPVLSYIRGQQFK
SSLVASASWSSQLSGECLVLLENGEVFVFELNERHCSGFRGCKMKVSWEDYQGKCWLGCEFGWRLGAFIVARSDSVFVIT
RTSGSCCSVRALLESESLDMAGTEEFVAFAKAGSSDHSFGFLLAFRSYLYLCDQRSGVLLLKWQHDVEKLCFIDVYSLSD
LGFRTDESTTSCVVVGSFGNAESQMFCYGPSPSVASDPSSLYVWELPHNLLSPAGKCLCGDCAIREVIMKESLPVWIDWQ
KKRVLVLGFGVLNKYLPSLSSSDGFTLIQLKSSGKLEALKFRSSPSLGGVVTHRDSTSDEEELCEKLNLCGFGRDRCSST
VTAVFDSINSPTSVLDIALRETWSSLPIDVLLLAFSNYTEVEGVLLDKKKPSLEFLSVPEFPQLPPFLLWKQECGLVLTS
LVLFSHSQFS*

DNA
ATGCCCAGGCCTACTTTCCCCGATCATCTCGGGTTGGTGGTGGTTTCCGTCTCCGGGGATGACATCCGGGTCATGGGTTT
GGATAAAGGTGAAGTCTTTGTAGCGAAAGAGCGGTTCTTTTCTAGAGTTTTGAAGATATTAGTGCAACCGAGTGGTGATT
TGAGAGTACATAATGAGTTGGGTTACGTTATGTCTCGAGGCAGACCGGTTTTGAGTTACATTAGAGGTCAACAGTTTAAG
AGCTCTTTGGTTGCTAGCGCTTCTTGGAGCTCTCAGCTTAGTGGAGAGTGTTTGGTGTTGTTAGAGAACGGCGAGGTCTT
TGTGTTTGAACTGAATGAGAGACATTGCAGTGGATTCAGAGGTTGCAAGATGAAGGTTTCGTGGGAGGATTATCAAGGGA
AGTGTTGGTTAGGGTGTGAGTTTGGTTGGAGGCTTGGGGCTTTTATCGTTGCTCGGTCTGATTCAGTTTTTGTTATCACC
AGAACCTCTGGGAGTTGTTGTAGTGTGAGAGCTTTGTTGGAGTCTGAGAGTCTGGACATGGCTGGAACTGAAGAGTTTGT
TGCGTTTGCCAAGGCGGGTAGTAGTGACCATAGTTTTGGGTTTCTTCTAGCTTTTAGGAGCTATCTGTATCTTTGTGATC
AGAGGTCAGGAGTGCTTTTGTTGAAATGGCAGCATGATGTTGAGAAGCTTTGCTTTATTGATGTTTATAGCTTGTCTGAT
CTCGGGTTTCGGACAGATGAATCAACCACTTCATGCGTTGTAGTAGGGTCGTTTGGGAATGCGGAGTCTCAGATGTTCTG
TTATGGACCTTCTCCTTCTGTTGCCAGTGATCCTTCTTCCTTGTATGTCTGGGAGCTTCCACACAATCTACTCTCACCAG
CTGGTAAATGTCTATGTGGAGATTGTGCAATTAGAGAAGTGATAATGAAAGAGTCTCTCCCCGTCTGGATCGATTGGCAG
AAGAAGAGAGTTCTTGTTCTTGGCTTTGGAGTTTTAAACAAGTACCTTCCATCACTCAGTTCATCAGATGGGTTTACTTT
GATTCAGTTAAAATCCTCGGGGAAGCTAGAAGCACTCAAGTTTCGTTCTTCTCCTAGCTTGGGAGGAGTAGTGACTCACA
GAGACTCCACCTCTGACGAGGAGGAGCTATGCGAGAAGCTGAATCTCTGCGGGTTCGGTAGAGACAGATGCTCCTCCACA
GTTACTGCAGTCTTCGACAGTATCAACTCACCAACGAGCGTTTTGGACATCGCGTTGAGAGAGACCTGGTCAAGCTTACC
TATAGATGTTCTGTTGCTTGCGTTCTCAAACTACACTGAGGTTGAAGGTGTTCTGTTAGACAAGAAGAAACCGTCTCTCG
AGTTTTTATCTGTTCCGGAGTTTCCGCAGCTACCGCCTTTTCTTTTATGGAAACAAGAGTGCGGCCTGGTGTTGACCTCA
TTGGTCCTGTTCTCCCACTCCCAGTTCTCTTAA