Details for Kale Locus Bo5g118670

Position : C5 ( 5`- 36388071 .. 36392090 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118670

Protein [Map View]
MVRRIKRKGFINTEAAREFFNHLVAERHSLLLLVPLVLAFWAIERWVFAFSNWVPLVVAVWASLQYGSYQRAILAEDLTR
KWKQNVFNASTITPLEHCQWLNKLLSEIWLNFMNKKLSLRFSSMVEKRLRQRRSRLIENIQLLEFSLGSCPPLLGLNGTC
WSQSGEQKILRLDFTWDTSDLSILLQAKLSKPFNRTARIVVNSLCIKGDILIRPTLEGKAMLYSFVSNPDVRIGVAFGGG
GGQSLPATELPGVSSWLVKILTETLNKKMVEPRRGCFSLPATDLHKTAVGGIIYVTVVSGSNLHRSVLRGSPSSRSPDIA
ESSNGGSSSNKPVQTFVEVELEQLSRRSEMRTGPNPAYQSTFNMILHDNTGTLKFNLYENNPASVRYDSLASCEVKLKYV
NDDSTMFWAVGYDNGVIAKHAEFCGQEVEMVVPFEGVSSSELTVRLLLKEWHFSDGSHSLNGVNSSSLHSLDGSASLFSK
TGRKIIVTVLAGKNLLVSKTGKCDANVKLQYGKTIQKTKTVNAAEGVWNQKFEFEELAGEEYLKVKCYREEMLGTDNIGT
ATLSLHGISNSEMHIWVPLEEVSSGEIELLIEALSPEYSEADSSKGLIELVLVEARDLVAADLRGTSDPYVRVQYGEKKQ
RTKVIYKTLHPKWNQTMEFPDDGSSLELHVKDHNTLLPTSSIGNCVVEYQRLKPNETADKWIPLQGVTRGEIRVRVTRKV
TEAPRRASADSSSPFNKALLLSNQMKQVMIKFQNLIDDGDLEGLGEALGELESLEDEQEEYLVQLQTEQMLLINKIKDLG
KEILNSSPVQATSHSPSRSGSGSGGGSYSRLRLPAPM*

DNA
ATGGTTCGGAGAATAAAGAGGAAAGGTTTCATAAACACCGAAGCTGCAAGAGAGTTTTTCAATCATCTAGTTGCGGAGAG
ACACTCTCTTCTGTTGCTGGTTCCTTTGGTGTTAGCTTTCTGGGCTATTGAGAGATGGGTCTTCGCTTTCTCCAACTGGG
TTCCTCTCGTCGTTGCTGTTTGGGCTTCTCTTCAGTATGGGAGTTACCAAAGGGCAATACTTGCAGAAGATCTAACCAGG
AAGTGGAAGCAAAACGTGTTCAATGCTTCGACTATAACTCCATTGGAACATTGCCAATGGCTGAACAAATTACTGTCTGA
AATTTGGCTAAACTTCATGAACAAAAAACTCTCTCTCAGATTTTCTTCTATGGTAGAGAAACGGTTGAGGCAACGAAGAT
CAAGACTAATAGAAAATATACAGTTGTTGGAGTTCTCTCTTGGCTCATGTCCTCCTTTGCTGGGACTCAACGGAACATGT
TGGTCTCAATCAGGGGAACAGAAAATCTTGCGGTTAGATTTCACTTGGGACACATCTGATCTAAGCATCTTGCTCCAAGC
CAAGTTGTCCAAACCGTTTAACAGAACAGCAAGAATCGTCGTCAACAGTCTTTGCATCAAAGGAGATATACTAATCAGAC
CAACTCTAGAAGGAAAAGCAATGCTCTATTCCTTTGTATCTAACCCTGACGTTAGAATCGGAGTTGCTTTCGGCGGTGGC
GGTGGCCAATCTCTTCCCGCCACAGAGCTTCCCGGTGTCTCCTCTTGGCTGGTGAAGATCCTAACGGAAACATTGAACAA
GAAGATGGTGGAGCCAAGACGAGGATGTTTCTCATTACCAGCCACCGATCTTCACAAAACAGCAGTAGGAGGAATCATCT
ACGTAACAGTAGTCTCCGGTAGCAACCTTCATCGCAGCGTCCTCCGCGGAAGCCCCTCCTCGAGAAGTCCCGACATTGCG
GAAAGTAGTAACGGTGGCAGCAGCAGCAACAAACCTGTACAAACGTTCGTGGAGGTCGAGCTAGAACAGCTGTCTCGAAG
AAGCGAGATGAGAACAGGACCCAATCCAGCTTATCAGTCAACGTTCAACATGATCTTACACGACAATACGGGGACGCTTA
AGTTTAACCTCTACGAGAATAATCCTGCTAGTGTCAGATACGACAGTCTCGCTAGCTGCGAAGTTAAGCTCAAATACGTT
AACGATGATTCTACAATGTTTTGGGCCGTCGGATATGATAACGGTGTGATAGCTAAACACGCTGAGTTCTGTGGTCAAGA
AGTTGAGATGGTTGTTCCCTTTGAAGGTGTTAGCTCCAGCGAGTTGACTGTGCGGCTACTTCTAAAGGAATGGCACTTCT
CTGATGGCTCACATAGCTTGAACGGTGTTAACTCAAGTTCTTTACACTCACTCGATGGATCGGCTAGCTTGTTCTCGAAA
ACCGGTCGGAAGATAATCGTCACGGTTTTAGCAGGGAAGAATCTTCTTGTTTCTAAGACTGGAAAATGCGACGCTAATGT
CAAGTTGCAGTATGGGAAAACTATACAAAAAACGAAGACGGTGAACGCGGCAGAGGGTGTGTGGAACCAGAAGTTTGAGT
TTGAGGAGTTGGCAGGAGAAGAATATCTGAAAGTGAAATGCTATAGAGAAGAGATGCTTGGCACTGACAACATCGGTACA
GCTACGTTGAGTCTTCATGGGATTAGTAACAGCGAAATGCATATATGGGTTCCTCTTGAAGAAGTTAGTTCTGGAGAGAT
AGAGCTTTTGATCGAAGCTCTTAGTCCTGAGTATAGTGAAGCGGATTCTAGTAAAGGCTTGATTGAACTGGTGCTTGTTG
AAGCGCGGGATCTCGTGGCTGCGGATCTTAGAGGAACCAGTGATCCTTACGTCAGGGTTCAGTACGGAGAGAAGAAACAG
AGGACAAAGGTTATTTACAAGACATTGCATCCCAAATGGAATCAGACAATGGAGTTCCCAGATGATGGGAGCTCCTTGGA
GCTACACGTCAAAGACCATAACACACTGCTTCCAACTTCAAGCATCGGTAACTGCGTTGTGGAATACCAACGGCTAAAGC
CAAACGAGACAGCCGACAAGTGGATACCTCTCCAAGGAGTGACACGTGGAGAGATCCGTGTGAGAGTCACGAGGAAAGTC
ACCGAGGCTCCAAGAAGAGCCAGCGCGGACTCTAGCTCTCCGTTCAACAAAGCGCTCTTGTTGTCTAACCAGATGAAGCA
GGTGATGATAAAGTTTCAGAATTTGATCGACGATGGAGATCTCGAAGGTCTTGGTGAAGCTTTGGGAGAGCTGGAGAGTT
TGGAGGATGAGCAAGAAGAGTATTTGGTCCAGCTTCAGACAGAGCAGATGCTGCTTATCAACAAGATTAAAGATCTTGGT
AAAGAGATTCTTAACTCGTCCCCTGTTCAAGCCACGTCTCATTCGCCGTCTAGGTCCGGGTCTGGTTCGGGAGGTGGATC
GTATAGCCGGCTAAGATTACCAGCGCCAATGTAG