Details for Kale Locus Bo5g118650

Position : C5 ( 5`- 36382483 .. 36384517 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118650

Protein [Map View]
MGRPPSNGSPAFRFNMAEVMEMEGILLQHNIAMPSRHILEDLADKFSESVERKGKIVVQFKQIWNWFQNRRYALRARGNK
APGKLNVSSSMPPGVDSTNQMRNVLSVPGVMRSDSYKSYLEFEAKSARDGAWYDVHNFLAHRNLETGDPEVQVRFAGFEV
GEDEWIKVKKHIRLRSHPCEASECVAVLAGDLVLCFQEGKDQALYFDAKVLDAQRRRHDIRGCRCRFLVRYSHDQSEEIV
PLRKICRRPETDYRLQQLHSSSNDFGKSNQLQKPAPDAAAAPQSSASVPIVVPEKKDPSLISASATSVQPGSNAATVPAG
SA*

DNA
ATGGGTCGGCCTCCAAGTAATGGCAGTCCGGCGTTCCGGTTTAACATGGCTGAGGTAATGGAGATGGAGGGAATATTGTT
ACAGCATAATATAGCAATGCCAAGTCGACATATTCTTGAAGATCTTGCTGACAAGTTTAGTGAATCAGTGGAGCGGAAGG
GGAAGATTGTTGTGCAGTTCAAACAAATATGGAACTGGTTCCAAAACAGGAGATATGCTCTAAGAGCAAGGGGGAATAAA
GCTCCTGGGAAGCTTAATGTGTCTTCTTCCATGCCGCCCGGTGTGGATTCAACAAATCAGATGAGAAATGTGCTTTCAGT
TCCCGGTGTCATGAGGAGTGATTCGTACAAATCTTACTTGGAATTTGAAGCCAAATCTGCCAGGGACGGTGCATGGTATG
ATGTGCATAATTTTCTAGCTCATAGAAACTTGGAGACTGGTGATCCGGAAGTGCAGGTTCGATTTGCGGGTTTTGAAGTT
GGAGAAGATGAATGGATAAAAGTCAAGAAGCACATAAGGCTACGATCACACCCATGTGAAGCATCAGAATGTGTTGCAGT
TCTTGCTGGAGATCTCGTTCTTTGCTTCCAGGAAGGTAAAGATCAAGCTCTCTATTTTGACGCCAAAGTTCTTGATGCAC
AAAGAAGAAGACACGATATAAGAGGTTGTCGTTGTAGGTTCTTGGTGCGTTACAGCCACGACCAGTCCGAGGAAATCGTT
CCCTTGAGGAAGATTTGCCGGCGGCCTGAAACAGATTACAGGCTACAGCAACTTCACAGTTCTTCCAATGACTTTGGTAA
GTCTAATCAGCTCCAAAAACCCGCTCCAGACGCGGCTGCAGCTCCACAATCCAGCGCATCAGTTCCCATTGTTGTACCCG
AGAAGAAAGATCCGAGTTTGATCTCCGCTTCAGCCACTTCAGTTCAACCTGGCTCCAATGCAGCCACTGTCCCCGCTGGT
TCTGCGTAG