Details for Kale Locus Bo5g118550

Position : C5 ( 5`- 36245317 .. 36247691 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118550

Protein [Map View]
MFTSLSAPSSLPSSLAFSLVSVKSHPAAGHIVPRRDLVSLRIRASKNGSSDYCFHEKLKSFAKSAILIGAAVSMTGKLST
LPAKAGYPVTTTVEVKEEKNSSEIEPTSPLTELLESTPEAVKTLRSLLQQKLENGEDEEALKLLEKLVTAQPEETEWKFL
MARLLGEMGRTENARQVFEEILQRNPLSFEALFENALLMDRSGEGDAVLQRLEDALAVAEAENMVKEIRDVRLIIAQIQF
LQKNVDEALKSYEQLTREDPKDFRPYFCRGMIYSLLDKNAEAKEQFAKYRELSPKKFEVEGFVHLICAIFFCCHCVPSWS
ISFYPQLILNFRRKSVVGLNFDFVLLNLTKHSSYMIYNACLYFSPIIQKQYFDTYGDQEVMIHVAANDVAFSIHAVVLTA
LTLFQIFIYERGPQKVSRFATGLVVLVWGFAAICFFIALPSHSWLWLITIFNSIQVSMTCVKYIPQSHLCPLPLMVQPII
WNYDHSLRLYPTPHTVYS*

DNA
ATGTTCACGTCTCTCTCAGCTCCTTCCTCGCTTCCTTCTTCATTGGCTTTCTCTTTAGTCTCCGTTAAATCTCATCCGGC
CGCCGGACATATTGTTCCCCGTCGTGATCTCGTCTCTCTGCGCATCAGAGCTAGCAAGAATGGTTCTTCGGATTACTGCT
TTCACGAAAAGCTCAAATCTTTTGCCAAATCGGCGATTCTGATCGGAGCTGCTGTTTCCATGACCGGAAAGCTCTCAACT
TTACCGGCGAAAGCAGGGTATCCGGTCACGACCACCGTGGAAGTGAAAGAAGAGAAAAATTCGTCTGAGATCGAACCCAC
TTCGCCATTAACCGAGCTTCTAGAATCCACTCCAGAGGCGGTCAAAACGCTGAGATCACTGCTTCAGCAGAAGCTAGAGA
ACGGAGAAGACGAAGAAGCTCTCAAGCTCTTAGAGAAGCTCGTAACCGCACAGCCAGAGGAAACAGAGTGGAAGTTTTTA
ATGGCGAGGCTATTGGGTGAAATGGGTCGTACCGAAAACGCACGCCAAGTGTTCGAGGAAATTCTCCAACGAAACCCACT
CTCGTTCGAGGCCTTGTTCGAGAACGCGTTGCTCATGGACAGGTCCGGGGAAGGAGACGCGGTGCTGCAGAGGCTGGAAG
ACGCGTTGGCTGTAGCTGAAGCTGAGAATATGGTGAAGGAGATTAGAGACGTGAGGCTGATCATTGCGCAGATACAGTTC
TTGCAGAAGAATGTGGATGAAGCGTTGAAGAGCTACGAGCAGCTGACGAGAGAGGATCCTAAGGATTTCAGACCGTATTT
CTGTCGAGGTATGATTTATAGCTTGCTTGACAAGAATGCTGAAGCCAAGGAGCAGTTTGCGAAGTATAGAGAGCTTTCGC
CAAAGAAGTTTGAAGTTGAAGGGTTTGTTCATCTGATCTGTGCTATTTTCTTCTGTTGCCACTGTGTTCCATCGTGGTCG
ATTAGCTTCTACCCTCAGCTGATTCTGAATTTCCGCAGGAAAAGTGTGGTTGGGTTGAACTTCGACTTCGTGCTGTTGAA
TTTGACGAAGCACTCGTCGTATATGATCTACAACGCCTGCCTCTACTTCAGCCCCATCATTCAAAAACAGTACTTTGATA
CTTATGGCGATCAAGAGGTGATGATACATGTGGCTGCTAATGATGTTGCCTTCTCAATCCATGCTGTTGTACTCACAGCT
CTTACACTCTTCCAGATCTTTATCTATGAACGTGGACCTCAGAAAGTATCCAGATTTGCTACAGGTCTTGTGGTTCTTGT
CTGGGGGTTTGCAGCTATCTGTTTCTTCATTGCTTTACCTTCGCACTCTTGGCTCTGGCTCATTACCATCTTCAACTCGA
TTCAGGTTTCCATGACATGCGTCAAGTACATTCCACAGAGCCACCTATGTCCTCTACCTCTCATGGTGCAACCTATCATT
TGGAACTACGATCATTCTCTTCGACTCTACCCAACTCCTCATACAGTATACTCTTAA