Details for Kale Locus Bo5g118530

Position : C5 ( 5`- 36219984 .. 36224582 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118530

Protein [Map View]
MEALQDGSERDKTTPPSSSSSSTSPIPVVTSFWKEFDLEKEKSILDEQGLRIAENQENSQKNRRKLAESTRDFKKASPED
KLGMFNSLLKGYQEEVDNITKRAKFGENAFLNIYQKLYEAPDPFPALASIAEQERKLSDVESENRKMKVELEEFRTEATH
LKNQQATIRRLEERNRQLEQQMEEKIKEVVEIKQRNLAEENQKTLELLKDREQALQDQLRQAKDSVSTMQKLHELAQSQL
FELRAQSDEEKATKQSELGLLMDEVERAQTRLLTLEREKGHLRSQLQTANEDTENKNSDNVDSNNMLENSLTAKEKIISE
LNMEIHNIETTLANEREDHVAEIKKLNSLLNKKDTVIEEMKKELQERPSAKLVDDLRKKVKILQAVGYNSIEAEDWDAAT
TGEEMSRMESLLLDKNRKMEHEVTQLKVQLSEKTSLLEKVEAKGDELTAKVNEQQRLIQKLEDDILKGYSSKERKGALFN
EWEFSEAGAAEQSESPMEQKHVPTDQDQSSMLKVICSQRDRFRARLRETEEEIRRLKEKIGFLTDELEKTKADNVKLYGK
IRYVQDYNHDKVVSRGSKKYVEDLESGFSSDVESKYKKIYEDDINPFAAFSKKEREQRVKDLGIRDRITLSSGRFLLGNK
YARTFAFFYTIGLHVLVFTCLYRMSALSYLSHGAEETPMTETTTNLPRGF*

DNA
ATGGAGGCCTTGCAAGATGGATCGGAGAGAGATAAAACAACTCCTCCTTCTTCTTCTTCTTCTTCAACCTCTCCCATTCC
TGTCGTCACCAGTTTTTGGAAAGAATTTGATTTGGAGAAGGAGAAGAGTATACTTGACGAGCAAGGGCTTAGGATAGCTG
AGAATCAAGAAAACAGCCAGAAGAATCGACGAAAGCTTGCAGAGAGCACCAGGGACTTCAAAAAAGCATCGCCTGAGGAC
AAACTTGGTATGTTTAACTCCTTGCTCAAGGGGTATCAGGAAGAAGTTGATAATATCACCAAGAGGGCCAAGTTTGGGGA
GAATGCTTTCTTAAACATCTATCAGAAACTCTATGAAGCACCCGATCCATTTCCTGCTCTTGCGTCTATTGCTGAGCAAG
AGCGTAAATTATCTGATGTGGAATCTGAGAATCGAAAAATGAAAGTTGAACTTGAGGAATTTAGGACAGAAGCGACTCAT
CTGAAAAATCAACAGGCCACAATAAGGAGACTAGAAGAACGGAACCGTCAGCTTGAGCAGCAGATGGAAGAAAAAATCAA
GGAGGTTGTTGAGATAAAGCAACGAAATCTGGCTGAGGAAAATCAGAAAACGCTGGAGCTTTTAAAGGATAGGGAGCAAG
CTTTGCAAGATCAGTTAAGGCAAGCAAAAGACAGTGTCTCCACTATGCAAAAATTGCATGAGTTAGCACAGAGCCAACTT
TTTGAACTTCGTGCTCAATCAGACGAAGAAAAAGCGACAAAGCAATCTGAACTTGGTCTATTGATGGATGAAGTGGAGCG
TGCTCAAACGCGACTCCTTACACTTGAGAGGGAAAAGGGACATCTACGGTCTCAGCTGCAAACAGCTAATGAAGACACTG
AAAACAAGAATAGTGACAATGTAGATTCAAATAATATGCTGGAGAATTCTTTAACTGCAAAAGAGAAGATTATATCAGAG
CTTAATATGGAAATTCACAATATTGAGACTACTCTAGCTAATGAGCGAGAAGATCATGTTGCCGAGATAAAGAAATTGAA
TTCGTTGCTCAATAAAAAGGATACTGTCATTGAAGAGATGAAGAAAGAGCTTCAAGAAAGACCATCAGCAAAACTAGTTG
ATGATCTGCGTAAGAAAGTGAAAATTCTGCAGGCTGTAGGTTACAATTCAATTGAGGCTGAGGACTGGGATGCTGCTACC
ACTGGTGAAGAGATGAGCAGAATGGAGTCGCTTCTTCTTGATAAAAACAGAAAAATGGAGCATGAGGTCACTCAGTTAAA
GGTTCAACTTTCTGAGAAAACCTCCTTGCTTGAGAAGGTTGAAGCCAAGGGAGACGAACTGACAGCTAAGGTTAATGAAC
AGCAAAGACTGATTCAAAAGTTGGAAGATGATATCTTGAAGGGTTACAGTTCGAAAGAGCGAAAAGGTGCTCTATTTAAT
GAGTGGGAGTTCTCAGAAGCAGGTGCGGCTGAGCAGTCTGAGTCTCCTATGGAGCAGAAACATGTTCCAACAGATCAAGA
TCAAAGCTCAATGTTGAAAGTTATCTGCAGCCAAAGAGATCGGTTCAGAGCACGGTTGCGGGAAACAGAAGAGGAAATAA
GGCGATTAAAAGAGAAGATAGGCTTTCTCACAGACGAATTGGAGAAGACCAAAGCAGACAACGTCAAACTCTATGGCAAA
ATCCGTTACGTCCAAGACTATAACCATGATAAAGTTGTTTCCCGAGGATCAAAGAAGTATGTGGAAGATCTGGAAAGCGG
ATTTAGCTCGGATGTGGAATCTAAATACAAGAAAATATACGAGGATGATATCAACCCATTCGCAGCATTCTCGAAAAAGG
AAAGAGAGCAACGGGTCAAAGATTTGGGAATTAGAGATCGGATTACACTAAGCAGTGGCCGTTTCCTTCTAGGAAACAAG
TATGCGAGGACGTTTGCGTTCTTCTACACAATAGGATTGCATGTACTGGTCTTCACTTGTCTCTACCGTATGTCTGCTCT
CAGCTATCTCAGCCATGGAGCTGAGGAGACTCCGATGACAGAAACAACCACAAACCTCCCTCGCGGTTTCTAA