Details for Kale Locus Bo5g118520

Position : C5 ( 5`- 36199942 .. 36201535 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118520

Protein [Map View]
MASARFLSLLPIVTLSLLLTTTDASSRSLPTSHETTVLDVVSSLQQTQHILSIDPTRSSLTTTTAAKESIPVFLNSSSPL
SLELHSRDTLVASQHKNYKSLVLSRLERDSSRVASIIAKVKLAVEGADSETHYQPEELTTPVISGASQGSGEYFSRLGVG
TPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDPIFDPSSSSTYKSLTCSAPQCASLRASACRSDKCLYQVRYGDGSFTVG
EYATDTVTFGSSGKVDNVALGCGRDNEGLFTGAAGLLGLGGGALSMTSQIKAKSFSYCLVDRDSGKSSSLDFNSVQVGAG
DATAPILRNSKIDTFYYVGFTGFSVGGQQVSIPSSAFAVDASGTGGVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKRG
TSSISLFDTCYDFSSLSTVKVPTVAFHFTGGKTLNLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLA
NHLIGLSANKC*

DNA
ATGGCTTCCGCAAGATTTTTATCTCTCCTCCCCATCGTCACTCTCTCTCTTCTCCTCACCACGACCGATGCTTCCTCTCG
CTCCCTACCAACATCACACGAAACGACCGTACTCGACGTCGTTTCATCTCTCCAGCAAACACAACACATCCTCTCAATCG
ACCCGACTCGTTCCTCACTCACCACCACCACCGCCGCAAAAGAATCCATCCCTGTCTTTCTCAACTCCTCTTCTCCACTC
TCTCTAGAGCTCCACTCCCGAGACACCCTCGTCGCGTCACAGCACAAAAACTACAAGAGCCTAGTACTGAGTCGACTCGA
GCGAGACTCATCCCGAGTCGCCTCAATCATCGCCAAAGTCAAACTCGCCGTCGAGGGCGCCGACAGCGAGACCCATTACC
AACCTGAGGAGCTCACGACACCTGTCATCTCCGGAGCTAGCCAAGGAAGCGGCGAGTACTTCTCCCGGCTCGGCGTCGGA
ACTCCGGCGAAGGAGATGTACATGGTGCTCGACACCGGAAGCGACATAAACTGGATCCAGTGCAAGCCTTGCTCCTCCTG
CTATCAACAATCCGACCCGATATTCGACCCGAGTTCATCCTCCACGTACAAGTCCCTCACTTGCTCCGCTCCACAGTGCG
CTTCTCTAAGAGCCTCGGCTTGCCGCTCAGACAAGTGTCTCTACCAAGTTCGTTACGGCGACGGGTCTTTCACCGTCGGT
GAATACGCAACCGATACGGTGACGTTTGGAAGCTCAGGTAAAGTAGACAACGTTGCTTTGGGGTGTGGTCGTGATAACGA
GGGACTCTTCACCGGAGCAGCCGGTTTACTCGGTTTAGGCGGTGGAGCTTTGTCGATGACGAGTCAGATCAAAGCGAAGT
CTTTCTCTTACTGCCTCGTTGACCGCGACTCGGGGAAGTCGTCGAGTCTTGATTTCAACTCGGTGCAAGTCGGCGCCGGA
GACGCGACGGCGCCGATCCTCCGTAACAGCAAGATCGACACTTTCTACTACGTCGGGTTCACTGGGTTCAGCGTCGGTGG
TCAGCAAGTCTCGATCCCTTCGTCGGCGTTCGCCGTCGACGCTTCGGGAACCGGAGGAGTGATCTTGGACTGTGGAACCG
CCGTGACTCGGCTCCAGACTCAGGCCTATAACTCGCTTCGCGACGCGTTCGTGAAACTCACGGCGAATCTCAAAAGAGGA
ACGTCGAGCATCTCTCTGTTCGACACGTGCTACGACTTCTCGTCTCTCTCCACCGTGAAGGTCCCGACGGTGGCGTTTCA
CTTCACCGGTGGAAAGACTCTTAATTTGCCGGCGAAGAATTACTTGATCCCTATTGATGATGCGGGGACGTTCTGCTTCG
CTTTTGCTCCGACGTCGTCTTCGTTGTCGATCATCGGGAACGTGCAGCAGCAAGGGACACGCATCACTTACGATCTAGCG
AATCATCTTATCGGGTTGTCAGCTAATAAGTGCTAA