Details for Kale Locus Bo5g118500

Position : C5 ( 5`- 36189991 .. 36192834 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118500

Protein [Map View]
MRCVGCSWSRPTGASRISFGGHLSSGFHRSHLSSSSLSFPSSGDASFLVSCSSTSEPSDHKDSSNRSYSRRWYNPLPRRR
HADQMPTSRIARDWIDSDTSTVSEDSERFTVVSYNILGDRNSSYHKDLYSNVSFPYLKWGYRKRLICEELIRLRPDIICM
QEVDKYFDLFSMMEKAGYAGSYKRRTGDNVDGCAIFWKADRFRVLERENIEFSQFGMRDNVAQLSVLELRKSMSRKILVG
NIHVLYNPNRGDVKLGQIRSLCTKAHLLSTKWGDIPIVLGGDYNSLPQSPLYNFLASSELNIMKQDKRELSGQRNRLPNQ
VLEAGGKPSNPITSINICSSSSWSNEEIRLATGQENSYWAVHPLKLHSSYASVKGSTNTRDSIGEPLATSYHSKFLGTVD
YLWYSDGIAPARVLDTLPIDVLCRTRGLPCQELGSDHLALVSEFFFEPNG*

DNA
ATGCGTTGCGTGGGTTGTTCTTGGTCACGGCCAACCGGAGCTTCTCGAATCTCCTTTGGTGGTCACCTTTCGTCTGGATT
TCACCGCTCTCATTTATCGTCGTCATCTCTCTCTTTTCCATCCTCTGGCGATGCGAGCTTCCTCGTGTCCTGCTCCTCCA
CATCTGAACCGTCCGATCATAAAGATTCGTCAAACCGCTCGTACAGCCGTCGATGGTACAATCCTCTTCCTCGGCGTCGA
CATGCCGATCAAATGCCAACTTCACGGATTGCTCGTGACTGGATTGATTCAGATACCTCTACCGTGTCCGAAGATTCAGA
AAGATTCACTGTCGTGTCATACAACATACTGGGAGATAGAAACTCATCGTATCACAAAGATTTGTACTCCAACGTCTCGT
TTCCTTACCTCAAGTGGGGTTACCGCAAAAGGTTGATATGCGAGGAACTCATTCGTCTCAGACCAGACATAATCTGTATG
CAGGAAGTAGACAAGTATTTCGATCTATTCAGCATGATGGAGAAAGCTGGATATGCTGGCTCCTACAAGCGGCGAACTGG
AGATAACGTTGATGGATGCGCAATCTTTTGGAAGGCTGACAGGTTTCGGGTTTTGGAGAGGGAAAACATTGAGTTTAGCC
AGTTTGGTATGCGTGATAACGTTGCACAACTTTCTGTTCTCGAGCTGAGGAAGTCTATGTCAAGAAAGATACTGGTGGGT
AACATTCATGTGCTTTATAATCCAAATAGAGGAGATGTGAAGCTGGGTCAGATCCGTTCGCTCTGCACAAAGGCTCACCT
GCTCTCTACGAAATGGGGTGATATTCCTATTGTTCTAGGCGGAGATTACAATAGCTTACCCCAGAGTCCATTGTACAACT
TCTTGGCGTCCTCTGAACTGAATATCATGAAACAAGACAAAAGGGAGCTGTCTGGCCAGAGAAATCGTCTTCCTAACCAA
GTTCTCGAGGCAGGAGGCAAACCTAGTAATCCAATAACTTCCATAAACATATGCTCAAGTAGCTCTTGGAGCAACGAAGA
GATCCGTCTCGCGACCGGGCAAGAGAACTCGTACTGGGCTGTGCATCCGTTGAAACTCCATAGCTCATACGCCTCAGTTA
AGGGTTCAACAAATACAAGGGACTCTATTGGTGAACCTCTAGCAACCTCGTACCACTCCAAATTTCTTGGAACGGTTGAT
TACCTCTGGTATTCAGATGGTATTGCACCTGCAAGAGTTCTTGATACACTTCCCATTGATGTCCTCTGCAGAACCAGAGG
CCTTCCTTGTCAAGAGTTGGGTAGCGATCACTTGGCATTGGTTTCTGAATTTTTCTTTGAACCGAATGGTTGA