Details for Kale Locus Bo5g118490

Position : C5 ( 5`- 36188446 .. 36188736 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g118490

Protein [Map View]
MALSSMTWAYARIIAGTLLGGTLGFYVMHRVEVSYKMKMEEALRQYEKDMKKRQEEENLGHISGDSA*

DNA
ATGGCGTTGAGCTCGATGACGTGGGCTTACGCACGGATCATAGCTGGAACACTTCTCGGTGGGACTCTCGGATTTTACGT
AATGCACCGCGTCGAAGTTAGCTACAAGATGAAGATGGAGGAAGCGTTAAGGCAATACGAAAAGGACATGAAGAAGAGAC
AAGAAGAAGAGAATCTCGGTCACATCAGCGGAGATTCAGCTTAG