Details for Kale Locus Bo5g117410

Position : C5 ( 5`- 36100797 .. 36102319 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117410

Protein [Map View]
MNDNKTFSTTTTINEEYMLFPYNDHYSSQPLLPFSPCSSINDILIHSNTSNNHLDHHHHQYLQAPASPFSHFESVPDFAL
LASFLPQKNGHNDNQTITTNDHHHPPSFLPFNNPFGESHLIEPSETKTTHIEDSQRISTSQDPNMKKVKKPSRTDRHSKI
KTVKGTRDRRMRLSLDVARELFGLQDMLGFDKASKTVEWLLTQAKPKIIKIANSLSNKFNHGRFSSCDESQPRPALGLMD
TSSDIFELSSMWTVEDRGSNTNMNETRGNKVDRRSVRGKRRMSQPRTPILMKLSKDARAKARERAKDRTKEKMMKRSAQV
NVVVEEEVHNHHDEIVQKNNKSNVKATPCEETIQEPLCKNDRFAVCNEIVVDKKYHISDEFNPSFPMLDHHRSQWAASSI
EFYRLSQIPIY*

DNA
ATGAACGACAACAAGACTTTCAGTACTACCACCACCATCAATGAAGAGTACATGTTATTCCCCTATAATGACCATTACTC
CTCACAACCATTACTCCCTTTTAGCCCTTGCTCTTCCATTAACGACATCTTGATTCACTCCAACACATCAAACAATCATC
TTGACCACCACCATCATCAGTACCTGCAAGCACCAGCTTCTCCTTTTTCTCACTTCGAATCCGTCCCGGATTTTGCCCTC
CTCGCCTCTTTCCTCCCACAAAAAAATGGCCATAATGATAACCAAACCATCACCACCAATGACCATCATCATCCTCCATC
ATTTCTTCCCTTTAACAACCCTTTTGGAGAATCTCACCTCATTGAGCCCTCAGAAACCAAAACCACACACATAGAAGATT
CCCAGAGAATCTCAACTTCTCAAGACCCAAATATGAAAAAAGTCAAGAAACCTAGCAGAACGGACCGGCACAGCAAGATC
AAAACGGTGAAAGGGACAAGAGACCGTAGGATGAGACTCTCGCTAGATGTCGCCAGAGAGTTGTTCGGCTTACAAGACAT
GCTTGGATTTGACAAAGCCAGCAAAACCGTTGAATGGTTGCTTACACAAGCTAAACCCAAGATCATAAAGATCGCGAACA
GCCTTTCAAACAAGTTCAATCACGGCCGGTTCAGCAGCTGCGACGAGTCTCAACCCAGACCGGCGTTAGGATTGATGGAC
ACATCGTCTGATATATTTGAACTTTCATCAATGTGGACAGTAGAGGATAGAGGCAGCAACACTAACATGAACGAAACAAG
AGGAAATAAGGTAGATAGGAGATCGGTGAGAGGGAAGAGAAGGATGTCGCAACCGCGAACTCCCATTTTGATGAAGTTGT
CTAAGGACGCGAGAGCGAAAGCAAGAGAGAGAGCAAAGGATAGGACAAAGGAGAAGATGATGAAGAGAAGTGCACAAGTG
AATGTTGTTGTAGAAGAAGAAGTTCATAATCATCATGATGAGATAGTCCAAAAGAATAATAAAAGCAATGTGAAGGCGAC
GCCCTGCGAAGAAACGATCCAAGAACCTCTTTGCAAGAACGATCGTTTTGCAGTTTGCAACGAAATTGTGGTGGATAAAA
AATATCACATTTCGGACGAATTCAATCCATCATTTCCGATGCTTGATCACCATCGCAGCCAATGGGCAGCTAGTTCCATA
GAGTTTTATAGGCTATCTCAGATCCCGATATACTAA