Details for Kale Locus Bo5g117400

Position : C5 ( 5`- 36092211 .. 36092678 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117400

Protein [Map View]
MEISRREHVLSVHQCLSVSFHVSLIVRCARYASRVSKKLKLKGRPKELLTTLSNKAKTMAGRKKKAYDGCGGTKAKTGLE
MVIEEEEEEEYGIWQRKILMGDKCEPLCYSGVIFYDCSGHQVKELPPRSPCSIWVPDRPTRSHVGSVLSSTEEEF*

DNA
ATGGAGATATCGAGGAGGGAACATGTTTTATCGGTCCACCAGTGTCTAAGCGTGAGCTTCCACGTCTCTCTCATAGTACG
TTGTGCTAGATACGCAAGCCGAGTCTCCAAGAAGCTTAAACTCAAAGGACGTCCTAAGGAGCTTTTGACGACTTTAAGCA
ACAAGGCCAAGACTATGGCTGGTCGGAAGAAAAAAGCTTACGACGGCTGTGGAGGTACAAAAGCAAAGACGGGGTTGGAG
ATGGTGATAGAGGAGGAAGAGGAGGAGGAATATGGCATTTGGCAGAGAAAGATTTTAATGGGAGACAAATGTGAGCCGTT
GTGTTATTCCGGAGTGATCTTCTACGATTGTAGTGGACATCAAGTAAAGGAACTGCCTCCGAGATCGCCATGTTCCATTT
GGGTGCCGGACCGGCCGACCCGTTCACATGTTGGGTCGGTGTTAAGCTCGACGGAAGAGGAATTTTAA