Details for Kale Locus Bo5g117390

Position : C5 ( 5`- 36091284 .. 36091781 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117390

Protein [Map View]
MAETFSRGDAQYWPIYGSSNTTERNSPYASLLRLLRSHSPTSSQLFGFLALFISGGILLFLLGVTVTVVGIGFVVFLPLI
IISSPVWIPVFIGVGGFLSVAGLLVGTLAVVSWAYRYFRGRHPVGSDQMDYARGRIYDTASHVKDYAREYGGYFHGRAKD
AAPGA*

DNA
ATGGCGGAAACGTTTTCTCGCGGCGACGCCCAATACTGGCCCATCTACGGTAGCAGCAACACCACCGAAAGAAACAGCCC
TTACGCTTCTCTTCTCCGCCTTCTCAGATCTCATTCACCAACCTCCTCACAGCTCTTTGGTTTCCTCGCTCTCTTCATAT
CCGGCGGAATCCTCCTCTTCCTCCTAGGCGTAACCGTGACGGTGGTCGGGATCGGCTTCGTTGTCTTTCTTCCGTTGATC
ATCATCTCGAGTCCGGTATGGATCCCGGTTTTTATCGGGGTTGGCGGGTTCTTATCGGTCGCCGGTCTTCTTGTTGGAAC
GTTGGCTGTCGTATCGTGGGCGTACCGTTATTTCCGTGGAAGGCACCCGGTTGGATCGGATCAAATGGATTATGCACGTG
GTCGGATCTATGACACGGCCTCTCACGTTAAAGATTATGCTAGAGAGTACGGTGGATATTTCCACGGTAGGGCTAAAGAT
GCAGCCCCTGGTGCTTAA