Details for Kale Locus Bo5g117380

Position : C5 ( 5`- 36090072 .. 36090978 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117380

Protein [Map View]
MANSMATVSRRLYRSLLCNPRFSQASMPFSTNNISDLSDTESPLETKASDPNHREERVMEERPLENGLDSGVFKAILVGQ
VGQLPLQKKLKSGRTVTLFSVGTGGIRNNRRPMINEDPREYANRSAVQWHRVSVYPERLADLVLKNVEPGTVVYLEGNLE
TKIFTDPVTGLVRRIREVAIRRNGRVVFLGKAGDMQQPSSVELRGVGYY*

DNA
ATGGCGAATTCAATGGCTACGGTTTCGAGAAGACTCTACCGATCTCTTCTCTGTAACCCCAGATTCTCTCAGGCTTCCAT
GCCCTTCAGCACCAACAACATCTCCGACTTATCAGACACTGAATCGCCCCTTGAAACGAAGGCTTCAGATCCAAACCATC
GAGAGGAACGCGTGATGGAGGAGCGTCCACTCGAGAACGGCCTTGACTCTGGCGTTTTCAAGGCGATATTGGTGGGGCAA
GTGGGGCAGCTTCCTCTGCAGAAGAAGCTCAAGAGTGGTAGAACTGTCACTCTCTTCTCTGTAGGCACCGGTGGCATCAG
GAACAACCGGAGACCGATGATCAACGAAGACCCGAGAGAGTATGCGAACCGCTCTGCTGTGCAGTGGCACCGTGTCTCTG
TTTACCCTGAGCGTTTGGCTGATCTTGTCTTGAAGAACGTTGAACCCGGCACTGTTGTCTACTTGGAGGGTAATCTTGAG
ACGAAGATATTCACTGATCCAGTTACTGGTTTGGTTCGACGTATTAGAGAAGTCGCTATTCGTAGAAACGGCAGAGTTGT
GTTTCTAGGAAAAGCCGGTGATATGCAGCAGCCAAGTTCTGTTGAGCTTAGAGGCGTTGGCTACTACTGA