Details for Kale Locus Bo5g117370

Position : C5 ( 5`- 36088722 .. 36089383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117370

Protein [Map View]
MSPLKKITLVTIIVSFYTFSSCVSSTEFEVGGDDGWLVPQSNKTHGDVFNQWASHNRFKVGDTVRFKYNKDSVLVVSSED
EYKKCKTTKPHFYSNNEDTVFKLDRPGFFYFISGVSGHCEKGQKMIIKVMEPEESTPDSPSPSSPSSSSSSPPSLPASTH
KKSNALKTTVQFSSSGFVVFAIIAVSVFGWV*

DNA
ATGAGTCCACTGAAGAAGATCACTCTCGTTACTATTATTGTTTCGTTTTATACGTTTTCATCATGTGTTTCAAGCACTGA
GTTTGAAGTTGGAGGAGATGATGGTTGGCTCGTACCACAATCTAACAAGACTCATGGAGATGTGTTTAACCAATGGGCTT
CACACAACCGCTTTAAAGTTGGCGACACTGTTCGTTTCAAGTACAACAAAGACTCAGTGTTAGTTGTGTCATCAGAAGAC
GAGTACAAGAAATGCAAAACTACTAAACCGCATTTTTATTCGAACAATGAGGATACTGTTTTTAAACTAGACCGTCCCGG
TTTCTTTTACTTCATTAGCGGTGTCTCGGGCCACTGCGAAAAGGGTCAGAAGATGATCATCAAAGTTATGGAGCCGGAGG
AGTCTACTCCAGATTCTCCTTCTCCTTCGTCCCCTTCTTCATCTTCTTCTTCTCCTCCATCTCTCCCGGCCTCTACTCAC
AAGAAGAGCAATGCCTTGAAAACAACAGTCCAGTTCAGTAGTTCCGGTTTTGTTGTCTTTGCAATTATAGCTGTTTCTGT
TTTTGGTTGGGTTTAG