Details for Kale Locus Bo5g117340

Position : C5 ( 5`- 36051924 .. 36055977 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117340

Protein [Map View]
MVKYKKESVTKVEAAPASTKKPSKKSKRDAEVDLDIQNNPKKQKKELIQAEKKAPPPKKVETSNSSDSKKELKKDTDVEM
AEAKQKSNAKQTQTNETPSTQARGGSNQLFAGNLSSKTKKSDLEKFFKGVGGEIKVVRLARGYAHVEFASVEAVQKALKL
NGKPLLGRKIKLDDFNKNPAPRSSNADGNFQRGEGSQVKTILVKKNRQMKTALRDHFSACGEITRFAIPCDQETGATKGM
AFLGFINDDGFNKALELNGSELGGRNIVVTEASTRVQNGDQKSGRRQGRRRGRPLRQRRRDSFKKDLEKAMVEAALDSKT
KPSKKSKRDVEVDLDIPKDAKKQKKELIQAVEKAPPKKNKKKKKKKKKNANVEMAEAEQKPIAKQPKTLFAGRLPFHIEK
SDLESFFKEVGEIKDVRLAKGIAHVEFASEEAAQKAMKLNGKPLLGRNILLDFANAKPAPRPRNLVKTIFVTGFNKSLSE
DEMKTSLRAHFSDCGEIKRISLPYYQETGDSKGVAYLDFSEDGFNKAMELNESELGGRNIVVIEARPKEKNADGNSGRGN
DDSSKRGPGRGNGEMRP*

DNA
ATGGTCAAGTACAAGAAAGAATCGGTCACCAAAGTAGAAGCAGCACCTGCCTCAACGAAGAAGCCATCCAAGAAAAGTAA
GAGAGATGCGGAAGTTGATCTGGACATCCAAAATAATCCCAAGAAGCAGAAAAAAGAGTTGATTCAAGCTGAGAAAAAGG
CACCACCACCAAAGAAGGTAGAGACCAGCAATAGTTCTGATTCTAAGAAAGAACTCAAGAAGGATACTGATGTTGAAATG
GCAGAGGCAAAGCAGAAATCAAATGCAAAACAAACGCAAACCAATGAGACACCAAGCACTCAGGCTCGAGGAGGATCAAA
TCAACTATTTGCTGGAAATCTTTCATCTAAAACTAAGAAATCTGACTTAGAGAAATTCTTCAAAGGAGTTGGTGGTGAAA
TCAAAGTTGTTAGACTTGCTAGGGGATACGCGCATGTTGAGTTTGCTTCCGTAGAAGCAGTTCAGAAGGCACTGAAACTG
AATGGTAAACCATTACTAGGCCGCAAGATTAAGCTTGATGATTTTAACAAGAATCCTGCTCCACGAAGCAGCAATGCTGA
TGGTAACTTCCAGAGAGGAGAAGGAAGCCAAGTTAAAACGATTTTGGTTAAAAAAAATCGGCAAATGAAAACTGCCTTGA
GAGATCATTTTAGTGCTTGTGGAGAGATCACAAGGTTTGCTATTCCTTGTGATCAAGAGACTGGCGCCACCAAGGGAATG
GCTTTCCTAGGTTTTATCAACGACGATGGATTCAACAAGGCGTTGGAACTAAACGGAAGTGAACTGGGAGGACGGAACAT
AGTGGTGACTGAAGCTAGCACAAGAGTACAGAACGGAGATCAAAAGAGTGGGCGTAGACAAGGACGTAGACGCGGACGTC
CACTCAGACAACGTAGACGTGACAGCTTCAAAAAGGACCTGGAAAAGGCAATGGTTGAAGCAGCACTTGACTCAAAGACG
AAGCCGTCGAAGAAAAGTAAGAGAGATGTTGAAGTTGATTTGGACATCCCAAAGGATGCCAAGAAGCAGAAGAAAGAGTT
GATTCAAGCTGTGGAAAAGGCACCACCAAAGAAGAACAAGAAGAAGAAGAAAAAGAAGAAGAAGAATGCTAATGTTGAAA
TGGCGGAGGCAGAGCAGAAACCAATTGCAAAACAACCCAAGACGTTATTTGCTGGACGCCTTCCCTTTCACATTGAAAAA
TCTGACTTAGAGAGTTTCTTCAAAGAAGTTGGTGAAATCAAAGATGTTAGACTTGCTAAGGGAATCGCACATGTAGAGTT
TGCTTCTGAAGAAGCAGCTCAGAAGGCAATGAAACTGAATGGTAAACCATTACTAGGCCGCAATATTCTGCTTGATTTTG
CTAACGCGAAGCCTGCTCCACGTCCACGAAACCTAGTCAAAACGATTTTTGTTACAGGATTCAATAAGTCTCTGAGTGAA
GATGAAATGAAAACTTCCTTGAGAGCTCATTTTAGTGATTGTGGAGAGATCAAAAGGATTTCTCTTCCTTATTACCAAGA
GACTGGTGATAGCAAGGGGGTGGCTTACCTAGATTTTAGTGAGGATGGATTCAACAAGGCAATGGAACTAAACGAAAGTG
AACTAGGAGGACGGAACATAGTGGTGATTGAAGCTAGACCAAAAGAAAAGAATGCTGATGGAAATAGTGGACGTGGCAAT
GATGACTCCTCCAAGAGAGGACCTGGAAGAGGCAATGGTGAGATGAGACCGTAG