Details for Kale Locus Bo5g117330

Position : C5 ( 5`- 36046182 .. 36047974 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117330

Protein [Map View]
MEDSSQGSFVTTINEDYESICWGCGLNLVLPSYAPVFKCGWCGAITNQNPVRPETRSLGLRRIRDQCFVVILAVFMLFVI
CGGIWAAYPVVFSISLACGIFHSVIAVSLAISTLSTFMVVAFKCAGKPIDIVYGTHPGVGNGTLNNYTFCHTCSKPKSPR
THHCRTCGMCVLDMDHHCPFIGNCVGAGNHKNFVAFLISAIISTSYSSVMCVYSLIHILPSLENGAAYASSHANNSGSIL
RGVKSIVLAYISNAIFISVRGLVLLYLFVASVSVAIGLSVLLWQQLSYIYEGKTYLSHLSSQGSEEDGEKSCGNLLTFFG
CPLLIERHLPTIRNLRKRHKT*

DNA
ATGGAAGACTCTTCCCAGGGGAGTTTTGTTACAACCATAAACGAAGATTATGAATCAATCTGCTGGGGCTGTGGACTGAA
CCTAGTTCTTCCATCATACGCACCTGTTTTCAAGTGTGGCTGGTGTGGCGCAATCACGAATCAGAATCCAGTCAGACCTG
AAACCAGAAGCCTTGGGCTAAGACGTATACGTGACCAGTGTTTTGTCGTTATTCTTGCTGTTTTCATGCTCTTTGTCATA
TGTGGTGGGATTTGGGCAGCTTATCCGGTCGTGTTTTCCATCAGCTTGGCTTGCGGGATTTTCCATTCTGTTATAGCAGT
GTCTCTGGCGATCTCAACGTTATCTACATTCATGGTTGTTGCTTTTAAATGCGCGGGGAAACCGATTGATATTGTTTATG
GAACCCACCCTGGAGTAGGGAACGGCACACTCAACAACTATACCTTTTGTCACACCTGCTCCAAACCAAAGTCACCTAGA
ACCCATCACTGTCGCACGTGTGGCATGTGCGTCCTCGACATGGATCATCATTGCCCCTTTATTGGTAACTGTGTTGGTGC
GGGCAATCACAAAAACTTCGTCGCCTTTCTTATCTCGGCCATTATAAGCACAAGCTACTCTTCTGTTATGTGTGTGTACT
CCCTGATTCATATCTTGCCATCCCTAGAAAATGGAGCAGCGTATGCATCATCACATGCTAATAATAGTGGATCGATTCTG
AGAGGGGTGAAGAGTATCGTGCTTGCTTACATATCCAACGCTATCTTCATCTCTGTACGAGGCCTTGTTCTATTATACCT
CTTTGTGGCGAGTGTTTCCGTGGCCATTGGGTTGAGTGTTTTGCTATGGCAGCAGCTTAGCTATATCTATGAAGGGAAGA
CTTACTTGAGCCATTTGAGTTCTCAAGGAAGCGAGGAAGATGGTGAAAAGAGCTGTGGGAATCTTTTGACGTTTTTTGGA
TGTCCACTTTTGATTGAGAGGCACTTGCCAACTATAAGGAACTTGAGGAAGAGACATAAGACATGA