Details for Kale Locus Bo5g117320

Position : C5 ( 5`- 36044039 .. 36045433 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117320

Protein [Map View]
MASPTSKTKTLMDYFQPPKRHKSSSSFPAVSAAGGSHGLDSAAKSPPPVTVTDDSSSLTPDQISRSELNKSVARSKRNLA
LCSEKVAKAKGEGSCYVPLTELVVEESWLKALPGELDKPYAKTLSCFLEREIIIDGKAPPIYPPQHLVFNALNTTPFDRV
KAVIIGQDPYHGPGQAMGLSFSVPEGEKLPSSLLNIFKELQKDVGCSIPRHGNLQKWAVQGVLLLNAVLTVRSKQPNSHA
KKGWEQFTDAVIRSISQQKEGVVFLLWGKYAQEKSKLIDGSKHHILTAAHPSGLSAHRGFFNCRLAQVH*

DNA
ATGGCTTCGCCGACATCTAAAACTAAAACCCTAATGGATTATTTCCAACCTCCCAAACGCCACAAATCTTCTTCTTCCTT
TCCCGCCGTTTCCGCCGCCGGTGGGTCCCACGGGTTGGACTCTGCAGCAAAATCGCCGCCTCCCGTAACCGTCACCGACG
ACTCGTCAAGCCTCACACCAGACCAAATCTCTCGCTCAGAGCTCAACAAATCCGTAGCCAGATCCAAGCGCAACCTCGCC
CTCTGCTCCGAGAAGGTCGCAAAAGCTAAAGGTGAAGGAAGCTGCTACGTGCCATTGACCGAGCTCGTAGTTGAAGAATC
ATGGCTCAAAGCTCTCCCTGGAGAATTGGATAAGCCTTACGCCAAGACCCTTTCTTGTTTCCTTGAACGTGAGATCATCA
TTGACGGTAAAGCCCCTCCTATTTACCCGCCGCAGCATTTGGTTTTCAATGCCCTAAATACAACTCCTTTTGATCGTGTC
AAGGCTGTTATTATCGGACAGGATCCTTACCATGGACCTGGTCAAGCTATGGGTTTGTCTTTCTCTGTCCCTGAAGGAGA
GAAGCTTCCTTCTAGTCTTTTGAATATATTTAAGGAGCTTCAGAAAGATGTTGGCTGTTCTATCCCTCGTCATGGCAATC
TACAGAAATGGGCTGTCCAGGGTGTTTTGCTGTTGAATGCTGTTCTCACAGTAAGGAGTAAGCAGCCTAATTCACATGCG
AAGAAAGGATGGGAACAATTCACTGATGCTGTTATTCGCAGTATCTCACAGCAGAAGGAAGGTGTTGTCTTTCTCCTCTG
GGGAAAATACGCTCAAGAGAAGTCCAAGTTGATAGATGGGAGTAAACATCACATTCTCACAGCAGCTCATCCGTCTGGTT
TGTCAGCGCATAGAGGCTTCTTCAATTGCAGGTTAGCTCAAGTCCACTAA