Details for Kale Locus Bo5g117270

Position : C5 ( 5`- 36018906 .. 36019226 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117270

Protein [Map View]
MVIEPCNCTFQLLMEHVNEIESYNGGDQGYLNEVFTWWHRIPKHMNFLKHFWVGDEDDVKRKKTELFGAEPPILYVLHYL
GMKPWLCYRDYDCNFNSDIFIEFATD*

DNA
ATGGTGATCGAGCCTTGCAACTGCACGTTTCAGCTTTTGATGGAACATGTAAACGAGATTGAGTCGTATAACGGTGGAGA
TCAAGGTTACTTGAACGAGGTGTTCACGTGGTGGCATCGGATTCCGAAACACATGAATTTCTTGAAGCATTTTTGGGTTG
GGGATGAAGATGACGTGAAGCGCAAGAAAACGGAGTTGTTTGGAGCAGAGCCTCCTATTCTTTATGTTCTTCATTACCTG
GGGATGAAGCCGTGGCTATGTTACCGTGACTATGACTGTAACTTCAACTCCGACATATTCATTGAGTTTGCGACAGATTG
A