Details for Kale Locus Bo5g117220

Position : C5 ( 5`- 35989894 .. 35992402 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117220

Protein [Map View]
MDTEKGYPRGFRADSIRSETDRGSFRSDSMQFDEPHELPPENSTNIVLFKHIDSGNLEATKDFLDRNPEALNASLTSNGD
RPIHKAVLSGHIKIVEEIVKRIHNPVQELEIKNDDGYTALAYAATGGIVRIAECLVKKCPRLVSVRNAKEHIPIVLASLY
GHKGLVRYLYNHTLLSDLDPCDELDEHKGKNGAMLVTNCIVDGLYGIALDLIQRYPKLAYTRDSDNDTAIIALAQTPCAF
PSGTHLAFWQRWVYSFPHIKKVYKLKLGHAQAKEILNCICQEIPNFDATQQKNAGLNQALFKAVENGIVEYIEEVMNHYP
DIVWFKDNYGLNLFFYAVSHRQEKIFSLIYKMGAKKNILATAWDKFHNNMLHHAAYKAPISRLNLIPGAALQMQRELQWF
KEVESLVQPKHRKMVNLKQKKTPQALFKDQHKELVDQGEKWMKDTATSCTVVAALITTMMFSSAFTVPDSYNGHSQLFMI
FLISDAISLFTSCMSLLMFLGILKSRYREEDFLRSLPTKQIVGLATLFLSMTTMMVSFVVTLMTLVRGRTPWVSAQFMVL
AVVPIGMFGVLQFPVLLEIFCSTYFPRVFDKPRESPRRSKLFWKK*

DNA
ATGGATACCGAGAAAGGCTATCCCAGAGGTTTCAGAGCTGACAGTATACGATCAGAAACCGACCGTGGAAGCTTCCGGTC
AGATAGTATGCAGTTCGATGAGCCGCACGAGCTACCACCAGAGAATTCGACTAATATCGTCCTCTTCAAGCACATAGACA
GTGGTAACTTGGAAGCCACGAAAGATTTCTTGGACCGAAACCCTGAGGCTTTAAACGCAAGTTTAACCTCTAACGGAGAC
CGACCGATCCACAAAGCTGTTTTGTCTGGTCACATCAAGATCGTGGAAGAGATCGTCAAACGAATTCACAATCCGGTGCA
AGAGTTGGAGATCAAGAACGACGACGGTTACACGGCGCTTGCTTATGCTGCGACAGGTGGGATTGTGAGAATCGCAGAGT
GTTTGGTGAAGAAATGCCCTCGTTTGGTTAGTGTTCGGAATGCTAAAGAACATATACCGATCGTGCTGGCTTCCTTATAC
GGTCACAAAGGTCTGGTTCGGTATCTTTACAATCACACACTTCTCAGTGATCTTGATCCTTGTGATGAGTTAGATGAACA
CAAGGGCAAGAACGGAGCGATGCTCGTGACAAACTGTATTGTCGATGGACTATATGGTATTGCTTTGGATCTGATTCAGA
GGTATCCTAAGCTGGCTTATACTAGAGACAGCGATAACGATACAGCGATCATTGCGCTTGCTCAAACGCCTTGTGCGTTC
CCTAGCGGTACCCATCTTGCGTTTTGGCAACGTTGGGTATATTCTTTTCCACACATAAAAAAAGTGTACAAACTAAAGCT
AGGGCATGCTCAAGCCAAAGAGATACTAAACTGTATCTGCCAAGAGATACCTAACTTTGACGCCACTCAACAGAAGAACG
CTGGTCTCAACCAAGCTCTCTTCAAGGCGGTTGAGAATGGTATCGTTGAGTATATCGAGGAAGTGATGAATCATTATCCT
GATATTGTGTGGTTCAAAGATAATTACGGTCTTAACCTCTTTTTCTATGCGGTAAGCCATAGGCAAGAAAAGATCTTTAG
CCTCATTTACAAAATGGGTGCCAAGAAAAACATCCTTGCTACAGCTTGGGACAAATTCCATAATAATATGCTTCATCACG
CCGCGTATAAAGCCCCAATTTCACGGCTTAATCTCATTCCTGGTGCTGCTCTTCAGATGCAAAGAGAACTACAGTGGTTT
AAGGAAGTGGAGAGCCTAGTGCAACCGAAGCATCGAAAAATGGTTAACTTGAAGCAGAAGAAAACTCCACAGGCTCTCTT
TAAAGACCAGCACAAGGAGCTAGTGGACCAAGGAGAGAAGTGGATGAAAGACACAGCCACTTCTTGCACAGTCGTCGCAG
CTCTGATCACCACAATGATGTTCTCCTCCGCCTTTACTGTCCCCGACAGTTACAACGGCCACAGCCAACTCTTCATGATC
TTCCTAATCTCAGACGCTATATCTCTCTTCACCTCATGCATGTCTCTGCTCATGTTCCTCGGCATTCTTAAGTCTCGTTA
CCGCGAGGAGGACTTCCTTAGATCGCTTCCGACGAAACAGATCGTGGGTCTTGCGACTTTGTTTCTCTCGATGACGACAA
TGATGGTGAGTTTTGTCGTGACGCTTATGACTCTGGTTAGAGGGAGAACACCGTGGGTTTCGGCTCAGTTTATGGTGCTC
GCTGTTGTCCCGATTGGGATGTTCGGTGTTCTTCAGTTTCCTGTGCTACTTGAGATCTTCTGCTCGACTTATTTCCCTAG
AGTTTTTGATAAGCCTCGCGAGTCGCCGCGAAGGTCTAAGCTCTTCTGGAAAAAATAA