Details for Kale Locus Bo5g117210

Position : C5 ( 5`- 35985772 .. 35987896 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117210

Protein [Map View]
MAIPLPLTSYSPISTSSSISRTSFVPLTPRHRNFFSEQNFSRRILISCSSSSSSSSNNGSTPESMNGSGLNGQSSFPGMP
SFDGTSKPPVKWRRVLLKVSGEALAGDEEQNIDPKVTMAIAREVAAVTRLGIEVAIVVGGGNIFRGSTWAGCSGLDRSSA
DYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEI
NAEVVLKATNVDGVFDDDPKRNPNARLHESLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLSEPGNIAKAIKGERVG
TLIGGTWNSTVAAT*

DNA
ATGGCGATTCCGTTGCCCCTCACTTCCTACTCGCCAATCTCAACTTCTTCTTCTATTTCCCGAACCTCTTTCGTCCCTCT
CACGCCTCGCCATCGTAATTTCTTCTCCGAACAGAACTTCAGTAGGCGTATACTTATCAGCTGCTCTTCATCTTCGTCTT
CGTCCTCTAACAATGGTTCAACTCCAGAGTCCATGAACGGGAGTGGGTTAAACGGGCAGTCATCGTTTCCTGGAATGCCT
TCCTTTGATGGAACATCTAAGCCACCGGTTAAGTGGAGAAGGGTTTTGCTTAAAGTCAGTGGAGAAGCTCTTGCTGGAGA
CGAGGAGCAGAATATCGATCCAAAGGTTACTATGGCGATTGCAAGGGAGGTTGCAGCAGTTACTCGTCTTGGCATTGAGG
TTGCGATTGTTGTTGGAGGAGGAAACATCTTCCGTGGATCCACCTGGGCTGGGTGCAGTGGCCTTGACCGCTCCTCTGCT
GATTACATCGGGATGCTGGCAACTGTGATGAACGCAATATTTCTTCAAGCGACAATGGAGAGCATCGGCATTCCAACACG
TGTTCAAACCGCTTTCCGCATGTCGGAAGTCGCAGAGCCTTACATCAGAAGACGAGCCATTAGACATCTAGAAAAAGGCA
GGGTTGTGATATTCGCAGCCGGAACAGGCAATCCGTTCTTCACAACCGATACTGCAGCAGCTCTCCGATGTGCTGAGATT
AACGCAGAAGTAGTACTGAAAGCAACAAATGTAGATGGAGTCTTCGACGATGATCCCAAGAGAAACCCAAACGCTCGCCT
CCACGAGTCACTAACTTACCAAGAAGTAACCTCAAAGGATCTCTCCGTTATGGATATGACTGCTATCACTTTGTGCCAAG
AAAACAACATCCCAGTTGTGGTCTTCAATCTGTCTGAGCCTGGAAACATCGCCAAAGCCATCAAAGGAGAGAGAGTTGGC
ACATTGATCGGAGGAACATGGAACTCTACTGTTGCAGCCACATGA