Details for Kale Locus Bo5g117200

Position : C5 ( 5`- 35984872 .. 35985516 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117200

Protein [Map View]
MDPSDYLTGNNPSDQQNQKRQLQIYGPRPSPLSVHKDSHKIKKPPKHPAPPPQHHHRDQAPVYAPREPVVIYAVSPKVVH
TTTSDFMNVVQRLTGISAGVFHESGNGGDVSPAARLAATENASPRGGKEPTAAKEETVEVATAMEEAAEFSGYAPGILSP
SPAMLPPASAGMFSPGWFSPSGLMSPFILYSPSYASLVASPTFADVFCSHIWDP*

DNA
ATGGATCCGTCGGATTATTTAACCGGCAATAATCCTTCCGATCAACAGAACCAGAAACGACAGCTTCAGATCTACGGTCC
TCGTCCTTCCCCTCTCAGCGTCCATAAAGACTCTCACAAGATCAAGAAACCTCCCAAGCACCCTGCTCCGCCTCCTCAGC
ATCATCACCGCGACCAAGCTCCGGTCTACGCTCCTCGAGAGCCGGTGGTAATCTACGCCGTCTCGCCGAAAGTCGTGCAC
ACCACAACCTCCGATTTCATGAACGTCGTCCAGCGACTCACCGGAATCTCCGCCGGGGTCTTCCACGAATCCGGAAACGG
CGGAGATGTGTCGCCGGCGGCGAGACTCGCAGCGACGGAGAATGCTAGCCCGAGAGGAGGAAAGGAACCGACGGCGGCTA
AAGAAGAGACGGTGGAAGTCGCCACGGCTATGGAAGAAGCAGCTGAGTTCAGTGGCTACGCTCCGGGGATACTCTCGCCG
TCTCCGGCTATGTTGCCGCCAGCTTCTGCTGGAATGTTCTCACCGGGATGGTTTTCTCCGTCGGGATTAATGAGCCCGTT
TATTCTTTATAGTCCTAGTTATGCTAGTTTGGTTGCTTCACCAACGTTTGCTGATGTCTTTTGTAGTCATATTTGGGATC
CTTAG