Details for Kale Locus Bo5g117170

Position : C5 ( 5`- 35961317 .. 35962588 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117170

Protein [Map View]
MGRDETETYITVPTFFKCPISLDVMRSPVSLCTGVTYDRPSIQRWLDGGNNTCPATMQILKSKDFVPNLTLQRLIKAWSD
SVGSSAAASPDPASARGIPTKEEVNESLMRLSQEKDDEIRLEILSRIVRFVKDSEASREFLSGREDLVPMLVDIVSAVTT
AKIKLAFIAIKILDTIIKKGNEGDRERLSKLMLLTNGGDCLTAILLAIQRGDLESKIEAVSVLEVISSYDAKSKMMIAER
EGILTELIKSISTESDPNLMETSLSFMITISKSKRVRSKLIAAKTITKIKDILMTEETISVAVTEKSLKLLEILSSKREG
RSEIFGGGCVEGVVKKLLKVSTTATEHAVTILWCLCHVFKEDKTVKETVERSNGVTKLLVVIQSNCSPMVRQMAKDLIKV
LKVKSSASALAAYETKTTHIMPF*

DNA
ATGGGGAGAGATGAAACCGAGACGTACATTACGGTGCCTACCTTCTTCAAGTGTCCGATATCTCTCGACGTGATGAGATC
TCCCGTTAGTCTCTGCACCGGCGTCACCTACGATCGTCCAAGTATCCAGCGGTGGCTCGACGGAGGCAACAACACTTGTC
CCGCCACTATGCAGATTCTCAAATCAAAGGATTTCGTTCCTAACCTCACTCTCCAACGGCTTATCAAAGCCTGGTCCGAC
TCAGTCGGTAGTTCCGCCGCTGCCTCCCCGGATCCGGCGTCTGCTCGAGGAATCCCGACGAAGGAAGAAGTGAATGAGTC
GTTAATGAGACTGAGTCAAGAGAAGGACGACGAGATTCGTCTTGAGATTCTATCGAGAATCGTTCGGTTCGTTAAGGATT
CAGAAGCGAGCAGAGAGTTTCTCTCCGGGAGAGAGGATCTCGTACCAATGCTCGTCGATATCGTCTCCGCCGTGACGACG
GCGAAGATCAAGCTAGCTTTTATAGCGATTAAGATTTTGGATACTATAATCAAGAAAGGTAACGAGGGAGATCGAGAACG
GTTATCGAAACTGATGTTGTTGACCAACGGTGGCGATTGCTTGACGGCGATTCTCCTCGCGATTCAGCGCGGGGATCTAG
AATCGAAGATCGAAGCCGTTAGTGTTTTGGAGGTTATCTCATCATACGACGCGAAATCGAAGATGATGATCGCAGAGCGC
GAGGGGATTCTAACGGAGCTAATCAAATCAATCAGCACAGAGTCGGATCCTAATTTGATGGAAACGAGTTTATCATTCAT
GATAACAATCTCGAAATCGAAACGAGTGAGATCGAAACTAATCGCCGCGAAAACGATCACGAAGATCAAAGACATTCTCA
TGACGGAGGAGACGATAAGCGTCGCGGTGACGGAGAAGTCTCTGAAGCTGTTGGAGATACTATCGTCAAAGCGAGAAGGT
AGATCGGAGATTTTCGGCGGTGGATGCGTGGAGGGAGTGGTGAAGAAACTGTTGAAAGTATCGACGACGGCGACGGAGCA
CGCCGTGACGATTTTGTGGTGTCTGTGCCACGTGTTTAAGGAAGATAAGACGGTGAAGGAGACGGTGGAGAGAAGTAACG
GCGTGACGAAGCTGTTAGTGGTGATTCAGAGCAACTGCTCGCCGATGGTGAGACAAATGGCGAAAGATCTGATAAAGGTT
TTGAAGGTTAAGTCATCTGCTTCCGCTTTGGCTGCTTACGAGACCAAGACCACACATATTATGCCATTTTGA