Details for Kale Locus Bo5g117150

Position : C5 ( 5`- 35943474 .. 35943755 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117150

Protein [Map View]
MVTKHQHYWMKRLSINPQALLLLFFCFFFILHCDASRALSPSSVFYIIPNDDHNKNTMRRDHFFGTLPRHLPVPASGPSR
KHNGIGLQALLSP*

DNA
ATGGTTACTAAACATCAACATTATTGGATGAAAAGGTTATCAATAAACCCACAAGCTCTTCTTCTTCTGTTCTTCTGCTT
CTTCTTCATTCTCCACTGCGACGCCTCGAGAGCCTTGTCACCATCAAGCGTTTTCTACATAATCCCTAATGATGATCACA
ACAAAAACACTATGAGGAGAGACCATTTCTTTGGGACCTTGCCAAGACACTTACCTGTTCCAGCTTCTGGTCCTTCACGA
AAACACAACGGCATTGGTTTACAAGCCTTGTTGTCTCCATGA