Details for Kale Locus Bo5g117140

Position : C5 ( 5`- 35935700 .. 35942526 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117140

Protein [Map View]
MGRLDLAAAKRAYRTATEVGNRSEEARWANNVGDILKNEGEYVEALKWFRIDYDISVKYLPGKDLLPTCQSLGEIYLRLQ
DFEEALIYQKKHLQLAEENNDTVEKQRACTQLGRTYHEIFLKSEDDCDAIQSAKKYFKKAMELAQALKEKPPPGESGSFL
EEYINAHNNIGMLDLDLDNPDAACKILMKGLRICDEEEVKEYDAMRSRLHHNLGNVYLELRSWKEAKEHIKMDIKICHQI
SHCQGEAKGYINLAELHNRTQNYGDALMCYGKASTLAKSMQDESALVEQIEQNIKIVKKAVKVMEEMREEERRLRKLSAE
MADAKGTSEERKSMLLVHACLERLIEKSSMVFAWDKHLEYSKRKKKISAELCDKEKLSDAYLVVGESYQKLRKFRKSLKW
VARSYEGYKAISNFEGQALAKINIGDGLDCIGEWTQALKEFEKGYRIALKANLPSVQLSALEHMHYSHMIRFGNAKEARE
LKEKIQNLESEHGERAECGTEDECSETDSEGHGYISNDRPNACSSPDLQTSNSPESEPLADFNEASDDVPLSSFLPPGRR
LSKRKQFSGKQDAETDQAKNDCSAPADSQQTVSGRKRIRVILSDDESETEYELGCPRRSFHKVTSQRKEVSDESMYFDGA
VNCTDNPAIQDHVEEGSCSFTSLRPTKAAPDANNCRPLTNTKAVEPTGCGIKGSQCEAGESNSTQCKHGSALVNFHTYSK
TDDQKIEIEIENVHMALDSCSGNDESVKVELTCLYYLQLPDDEKSKGLLPIIHHLEYGGRVLKPSDLYEVLSGSSENVVI
EASVSGWVHKRLMKLYMDCCQNLSEKPSIKLLKKLYISEVEDDISVSECELQDVSAAPLLRALDVHNTVAMLDLSHNMLG
NGTMEKLKQLFASSNQMYGALTLDLHCNRFGPTALFQICECPVLFTRLEVLNVSSNRLTDACGSYLSTILKNCRALYSLN
VEKCSLTSRTIQKIADALDPESGLSQLYIGYNNPISGGAIQNLLAKIATLSSFTELSMNGIKLSSQVVSSLSALVKTPSL
SKLLVGSSGIGTDGAIKITEALCYQKEETVKLDLSSCGLASPFFLKLIQDVTLTSSILELNVGGNLITEEGVSALGMLLA
NPCSNIKVLILNKCHLKLSEILCIIQALSDNKNLEELNISENAKMDETLFGEPVSGSSEMEQKEHGTCESITVMDKTHSE
HCWQNQDKEQELCEANMECGDGLEVADSEDEQIEEQTATSSSLSLPRKNHIIKELSTALAVANQLQILDLSHNGLSVEAL
ETLYMAWSSSGSRAGIAQRHVKDEIVHFCVEGKMCCGVNPCCRKD*

DNA
ATGGGCCGATTAGATTTAGCGGCGGCGAAGAGAGCTTACAGGACAGCGACGGAAGTAGGTAACCGGAGCGAAGAGGCGAG
ATGGGCCAATAACGTCGGCGATATCCTCAAAAACGAAGGAGAGTACGTGGAGGCTCTCAAGTGGTTTCGAATCGATTACG
ATATCTCCGTCAAGTATTTGCCCGGGAAGGATCTGCTGCCTACGTGTCAGTCTCTCGGCGAGATCTATCTCCGTCTCCAG
GACTTCGAAGAAGCCTTGATCTATCAGAAGAAGCATTTGCAGCTAGCTGAAGAGAACAACGACACCGTGGAGAAGCAACG
AGCTTGTACTCAGCTCGGCCGTACCTACCATGAGATATTCTTGAAATCTGAGGACGATTGCGACGCGATTCAGAGTGCTA
AGAAGTACTTCAAGAAAGCCATGGAGCTTGCACAGGCTCTCAAGGAGAAACCGCCTCCTGGAGAATCTGGAAGCTTTCTT
GAGGAGTATATCAACGCGCATAACAACATCGGTATGCTTGACCTTGATCTTGATAATCCCGATGCTGCTTGTAAGATTCT
CATGAAAGGACTGAGGATTTGCGATGAAGAGGAGGTTAAGGAGTATGATGCTATGCGTAGTAGGCTTCATCATAACCTTG
GGAACGTTTATCTGGAGCTGAGGAGTTGGAAAGAGGCTAAAGAGCATATCAAGATGGATATCAAGATCTGCCATCAGATA
AGTCACTGCCAAGGAGAAGCTAAGGGGTATATCAATCTTGCTGAGTTGCACAACAGGACGCAAAACTACGGGGATGCGCT
TATGTGTTATGGTAAAGCTTCTACTCTAGCGAAATCTATGCAAGACGAGAGTGCGTTGGTTGAACAGATAGAGCAGAATA
TCAAGATTGTGAAGAAAGCCGTTAAAGTTATGGAAGAGATGAGGGAAGAAGAGCGTAGGCTTAGGAAGTTGTCTGCTGAA
ATGGCTGATGCCAAAGGCACTTCGGAGGAACGGAAGTCTATGCTTCTAGTGCATGCGTGTCTTGAACGTCTCATTGAAAA
ATCCAGCATGGTATTTGCATGGGATAAGCATCTTGAATATTCAAAAAGGAAGAAGAAAATATCAGCTGAACTCTGTGACA
AGGAAAAGCTGAGTGATGCCTACTTGGTTGTTGGAGAGTCCTATCAAAAGCTTAGAAAATTCAGAAAATCCCTGAAGTGG
GTCGCAAGAAGTTATGAGGGATACAAAGCAATTAGTAATTTCGAGGGACAAGCATTGGCGAAAATTAATATAGGTGATGG
TTTGGACTGTATTGGTGAATGGACACAAGCACTCAAAGAATTTGAAAAGGGATACAGAATTGCTTTGAAAGCCAATCTTC
CTTCAGTTCAGCTTTCTGCACTGGAACATATGCATTATAGCCATATGATCAGATTTGGGAATGCTAAAGAAGCCAGGGAG
TTGAAGGAAAAAATACAAAATCTGGAGTCAGAACATGGTGAGAGAGCAGAATGTGGTACAGAAGATGAATGCTCTGAAAC
CGACTCAGAAGGGCATGGGTACATATCAAATGATAGGCCAAATGCATGTAGTTCGCCAGATCTCCAAACATCAAATTCAC
CTGAATCAGAACCGTTAGCAGATTTTAATGAAGCAAGTGATGACGTGCCACTAAGTTCATTTCTCCCGCCTGGTAGACGT
CTTTCCAAAAGGAAACAGTTTTCAGGAAAACAAGATGCTGAGACTGATCAGGCCAAGAACGATTGCTCTGCACCAGCAGA
CTCTCAGCAGACAGTCTCTGGTCGGAAGCGTATTCGTGTAATCCTCTCTGACGATGAAAGTGAAACCGAATATGAGTTGG
GATGCCCCAGACGCAGTTTTCACAAAGTTACAAGTCAGCGTAAGGAAGTCTCTGATGAAAGTATGTATTTTGATGGCGCT
GTTAATTGTACGGATAATCCTGCTATTCAAGACCATGTAGAAGAAGGTTCTTGCTCGTTTACGTCTCTCCGTCCCACTAA
AGCTGCTCCAGATGCCAACAATTGCAGACCTCTGACCAATACTAAAGCTGTTGAACCAACTGGTTGCGGTATAAAAGGAT
CTCAATGTGAAGCTGGCGAATCCAACAGCACGCAATGCAAACATGGATCTGCTCTCGTGAACTTCCACACTTATTCCAAG
ACAGATGATCAAAAAATTGAAATTGAAATTGAAAATGTACACATGGCTTTAGACTCGTGTTCTGGCAATGATGAGTCTGT
GAAGGTGGAACTTACTTGCTTGTACTATTTACAGCTTCCTGATGACGAGAAATCTAAAGGTCTGTTGCCTATCATTCATC
ATTTGGAGTATGGTGGTAGAGTTTTGAAACCATCGGATTTATATGAGGTTCTCTCGGGCTCTTCTGAAAACGTTGTTATT
GAAGCTTCCGTTAGTGGCTGGGTTCACAAGCGTCTGATGAAACTATACATGGACTGTTGCCAAAATTTGTCAGAGAAACC
CAGTATAAAATTGCTTAAGAAATTATATATTTCGGAGGTAGAGGATGATATCAGTGTGTCAGAATGTGAACTGCAAGATG
TATCAGCTGCTCCTTTATTGCGTGCCCTCGATGTGCATAACACAGTTGCAATGTTGGATCTCTCCCACAATATGCTAGGG
AATGGAACAATGGAGAAACTGAAACAACTTTTTGCCTCATCAAACCAGATGTATGGTGCTTTAACTTTGGATTTGCACTG
CAATCGATTTGGTCCAACTGCTTTGTTTCAGATCTGCGAATGCCCTGTTCTGTTCACTCGGCTGGAAGTCCTCAATGTGT
CCAGTAATCGACTTACTGATGCTTGTGGATCATACCTCTCAACCATCTTGAAAAACTGTCGGGCACTTTACAGCTTGAAT
GTGGAAAAGTGTTCACTCACATCTAGAACAATCCAAAAGATTGCTGATGCTTTGGATCCGGAGTCGGGACTTTCACAACT
CTATATAGGTTATAATAATCCTATTTCAGGGGGTGCCATTCAAAACCTCTTGGCTAAAATAGCTACTCTAAGCAGCTTTA
CAGAACTGAGCATGAATGGCATAAAGCTGAGCAGCCAAGTTGTTAGTAGCCTCTCCGCACTTGTTAAGACTCCATCTTTA
TCAAAACTTTTGGTTGGCAGCAGTGGCATTGGAACGGACGGAGCTATCAAAATCACTGAAGCTCTATGCTATCAAAAGGA
AGAAACTGTTAAGCTCGACCTTTCATCTTGTGGACTAGCGTCTCCTTTCTTTCTTAAGCTCATCCAAGATGTTACTCTAA
CTTCTAGCATTCTTGAGCTCAATGTTGGAGGAAATCTAATCACTGAAGAGGGAGTTAGTGCACTGGGGATGCTGCTTGCG
AACCCTTGTTCTAACATAAAAGTTCTGATTTTAAACAAGTGTCATCTGAAGCTCTCTGAAATTCTATGCATAATTCAAGC
ACTTTCAGATAATAAGAATCTCGAAGAGCTTAATATCTCTGAGAATGCTAAAATGGATGAGACTCTGTTTGGCGAGCCTG
TGAGTGGAAGCTCAGAAATGGAACAGAAAGAACATGGTACATGTGAATCCATCACCGTAATGGACAAAACTCACAGTGAA
CATTGTTGGCAGAACCAAGACAAAGAACAAGAGTTATGTGAAGCCAATATGGAGTGTGGTGATGGTCTTGAAGTTGCAGA
CAGCGAAGATGAGCAAATAGAGGAACAAACTGCAACGTCGAGTAGTCTTAGTTTACCACGCAAGAACCATATTATCAAAG
AGCTTTCGACCGCGCTTGCAGTGGCTAACCAATTGCAGATTCTAGATCTAAGCCACAATGGGTTGTCAGTTGAAGCCTTG
GAAACATTATACATGGCATGGTCATCATCAGGATCGCGAGCTGGCATAGCCCAAAGACATGTGAAAGATGAGATTGTCCA
TTTTTGCGTTGAAGGAAAGATGTGTTGTGGAGTCAATCCATGCTGCAGAAAGGATTAA