Details for Kale Locus Bo5g117130

Position : C5 ( 5`- 35934908 .. 35935345 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117130

Protein [Map View]
MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHHYNGNNVD
LGTACGKYFRVSCLSIVDPGDSDIIKSLPGDQ*

DNA
ATGGTTGCGGCGAAGAAGACGAAGAAGTCCCATGAGGGAATCAACAGTAGACTAGCTCTTGTGATGAAGAGTGGAAAGTA
CACTCTTGGCTACAAATCCGTTCTCAAGTCCCTTCGCAGCTCCAAAGGTAAGTTGATTCTCATCTCTAGCAACTGCCCTC
CGTTGAGGAGATCAGAGATTGAGTACTACGCTATGCTTGCTAAAGTTGGTGTTCATCACTACAATGGCAACAATGTCGAT
TTGGGAACTGCTTGTGGAAAATACTTCCGTGTTTCATGCCTCAGCATCGTTGATCCAGGTGATTCCGACATCATCAAGTC
GCTTCCGGGAGACCAGTGA