Details for Kale Locus Bo5g117120

Position : C5 ( 5`- 35932873 .. 35933784 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117120

Protein [Map View]
MPLYDCMLLFKPIIRKEGLIDLVARIGKHVYSKNGVLTEVKSFGKVELGYGIKKLDGRHYQGQLMQITMMATPNINKELH
YLNKDDKLLRWLLVKHRDIKIGSSEMEDRQDDSNRVTNRSLYDESSTDEDDDILGLSR*

DNA
ATGCCGCTGTACGACTGTATGCTTCTGTTCAAGCCAATAATCAGGAAGGAAGGTCTGATCGATCTGGTTGCTCGCATCGG
GAAACATGTTTACAGCAAAAATGGAGTTCTCACGGAGGTCAAATCCTTCGGCAAGGTCGAATTGGGTTACGGTATCAAAA
AGCTCGACGGTAGACACTATCAGGGGCAATTGATGCAGATAACAATGATGGCAACTCCAAACATTAACAAGGAGCTTCAC
TACCTCAACAAGGACGACAAACTCCTCCGCTGGCTCCTTGTTAAACACCGTGATATCAAGATTGGTTCATCCGAAATGGA
AGATCGTCAGGACGACTCTAACAGAGTGACTAATAGGAGCTTGTATGATGAGTCTTCTACGGACGAAGACGACGATATCT
TAGGCTTATCTCGATGA