Details for Kale Locus Bo5g117090

Position : C5 ( 5`- 35911606 .. 35912244 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117090

Protein [Map View]
MSSDHLPSSSQVFQEHFISRKLLQQLPFSHTIQQQQAHAPEKNNLSGNVLLLLSVLVCGIICSLGLHYVIRCVFRRHSSF
MISEPISSPSTLAANKGIKKKALKMFPVVKYSREMNLSGLGEDCVICLSDFVAGEQIRLLPKCNHGFHVRCIDKWLTQHI
TCPKCRHCLVETCQKILGDCDEALQVPARESIDIRIAPLEREARVNTFRESR*

DNA
ATGTCTTCAGATCACTTACCTTCTTCATCTCAAGTCTTCCAAGAACATTTCATCTCGAGAAAATTGCTTCAGCAACTCCC
ATTTAGTCACACCATACAACAGCAACAAGCTCATGCACCTGAAAAGAACAACTTGAGCGGCAACGTTCTCCTTCTTCTCT
CAGTCCTTGTGTGCGGTATCATCTGCTCACTTGGGTTGCATTACGTAATCCGGTGCGTGTTCAGACGTCACTCGAGCTTC
ATGATCTCTGAACCCATCTCAAGCCCGTCCACACTAGCAGCAAACAAAGGCATCAAGAAGAAAGCTCTCAAGATGTTCCC
AGTAGTGAAATACTCACGTGAGATGAACCTCTCAGGGCTCGGCGAGGATTGTGTTATTTGTTTGTCTGATTTCGTAGCTG
GTGAACAGATACGGCTGCTTCCTAAGTGCAACCACGGGTTCCACGTTCGTTGTATCGACAAGTGGCTTACGCAACATATC
ACTTGTCCGAAATGTAGACACTGTCTGGTTGAGACATGCCAAAAGATCTTAGGCGACTGCGATGAAGCTCTTCAGGTTCC
AGCAAGGGAAAGCATAGATATCAGAATTGCTCCTCTAGAACGTGAAGCAAGAGTAAACACTTTTAGAGAAAGCAGATAA