Details for Kale Locus Bo5g117030

Position : C5 ( 5`- 35868532 .. 35869422 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g117030

Protein [Map View]
MARNEEKAQSMLNRFVTMKESENKKPKERRPYLASECRDLADADKWRHQIMREISRKVAEIQNEGLGEHRLRDLNDEINK
LLRERWHWERRIVELGGPNYNRHGAKMTDLEGNIIDVPNTSGRGPGYRYFGAAKKLPGVRELFEKPPELRKRRTRYDIYK
RIDASYYGYRDEEDGVLEGLERSAEGEMRRREVEEWRRLDEVRKEARKGAAEVVSVGAAKEVLFEEEEDVVEEERKEREK
EEEKEREFVVHVPLPDEKEIEKMVLQKKKMELLREYASDDLVEQEKEAKAMLNIHR*

DNA
ATGGCTCGTAACGAGGAGAAAGCGCAGTCGATGCTCAACAGGTTCGTCACCATGAAAGAGTCCGAGAACAAGAAACCAAA
GGAGCGTCGACCTTACCTCGCCTCCGAGTGCAGAGATCTCGCAGACGCGGACAAATGGAGGCACCAAATCATGCGAGAGA
TCAGCCGCAAAGTCGCCGAGATCCAGAACGAAGGACTAGGCGAGCACCGCCTCCGCGACCTCAACGACGAGATCAACAAG
CTCTTGAGAGAGAGATGGCACTGGGAGCGACGGATCGTCGAGCTGGGAGGTCCTAATTACAACAGACACGGCGCGAAGAT
GACGGATCTCGAAGGAAACATCATCGACGTTCCCAACACTAGCGGACGTGGCCCTGGCTACCGTTACTTCGGCGCGGCGA
AGAAGCTTCCTGGTGTGAGAGAGCTTTTCGAGAAGCCGCCTGAGCTGAGGAAGAGGAGGACGAGGTATGATATCTATAAG
AGGATAGACGCTAGCTACTATGGTTATAGGGATGAGGAGGATGGGGTGTTGGAGGGGCTGGAGAGGAGTGCGGAGGGGGA
GATGAGGAGGAGGGAGGTGGAGGAGTGGCGGAGGCTGGATGAGGTTAGGAAGGAGGCGAGGAAGGGGGCGGCGGAGGTTG
TGAGCGTTGGAGCTGCGAAGGAGGTGTTGTTTGAGGAGGAGGAGGATGTGGTGGAGGAGGAGAGGAAGGAGAGGGAGAAA
GAGGAGGAGAAGGAGAGGGAGTTTGTGGTTCATGTTCCCTTGCCTGATGAGAAGGAGATTGAGAAGATGGTGCTGCAGAA
GAAGAAGATGGAGTTGCTTAGAGAGTATGCTAGTGATGATTTGGTTGAGCAGGAGAAGGAGGCTAAAGCCATGCTCAACA
TCCACAGATAG