Details for Kale Locus Bo5g116930

Position : C5 ( 5`- 35831412 .. 35833436 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116930

Protein [Map View]
MNCLKYGFLHHTRSIKSGITLTTVCSNHLVDLYSRNGLLQEARKVFDEMPERNVYSWNAMISAYVKSNDLKEANKLFRTV
NSERDLVTCNTLLSGFAKTDGCESEAIEMFGEMQRKEEDGVWIDDFTLTTMLKLSAKLTNAFYGEQLHGVMVKTGNDASK
FAVSSLVHMYSKCGKFKEVCNVFNGSCVQVIDGVAKNAMLAAYCREGDVERALSIFLRNPELNGTVSWNTLVWGYVQNGF
EEEALKMAVRMEESALKWDEHTTAAVLNVVSSLKSLKIGKEVHGRVVKNGSYSNKFISSGIVDVYCKCGDMKYAESVHLL
YGIGDLYSTSSMIVGYSSQGKMVEARRLFDSLSEKNLVLWNAMFLGYLKVCQPDSVLELAREFIAKDKVTDSSVMVSILG
ACSLQASIEPGKEIHCHSLRSGTLMDKKLVTAFVDMYSKCGNVEYAAKVFDSSFERDTVMYNAMLSGYAHHGHDAKAFKL
FEEMTEAGLKPDEITFISLLSACRHSGLVLEGEKYFKSMTEVYSISPEVGHYTCIIDLYGKTSRLDKAIELMRGIDQVEE
DAVILGAFLNACNLNKNTELVKEVEEKLLEIDGCNGSRYIHLANSHASSGRWDEMRQIRNRMRGKELGKFYGCSWAYIDN
QLHMFRSSDISHFRTEAIYSMLHFVTKDSTEMIA*

DNA
ATGAATTGCTTAAAATATGGTTTTTTGCATCACACTCGCTCCATTAAATCTGGAATAACCTTGACAACAGTCTGCTCGAA
CCATCTCGTTGATCTCTACTCAAGAAATGGACTATTGCAGGAAGCTCGTAAGGTGTTCGACGAAATGCCTGAGAGAAACG
TTTACTCATGGAATGCTATGATCTCGGCCTACGTAAAGTCCAACGATTTGAAAGAAGCGAATAAACTGTTCAGAACTGTT
AATTCTGAACGAGATTTGGTAACCTGTAACACTTTGCTTTCAGGGTTTGCCAAAACTGATGGGTGTGAGAGTGAAGCCAT
TGAGATGTTCGGTGAGATGCAAAGGAAAGAAGAGGACGGGGTTTGGATTGACGATTTCACTCTCACTACAATGCTCAAAC
TCTCTGCGAAGCTAACCAACGCGTTTTATGGTGAGCAGTTGCATGGCGTTATGGTGAAAACAGGGAATGATGCAAGCAAG
TTTGCCGTGAGCTCTCTCGTTCACATGTACTCGAAGTGTGGGAAGTTTAAGGAAGTTTGTAATGTATTTAACGGATCGTG
TGTTCAGGTTATTGATGGTGTGGCTAAGAACGCGATGCTTGCTGCTTATTGTAGAGAGGGTGACGTTGAAAGAGCTTTGA
GTATATTCTTGAGAAATCCAGAACTGAACGGTACAGTTTCTTGGAATACATTGGTTTGGGGATATGTGCAGAATGGATTT
GAGGAAGAAGCTTTGAAGATGGCTGTTAGAATGGAGGAAAGTGCGTTGAAATGGGATGAACACACTACCGCGGCTGTACT
AAATGTTGTGAGTAGTTTAAAGAGCTTGAAGATTGGGAAGGAAGTGCATGGTCGGGTGGTGAAGAACGGATCATATTCTA
ATAAGTTTATAAGCAGTGGGATTGTTGATGTTTACTGTAAGTGTGGAGACATGAAGTATGCAGAGTCTGTCCATTTGTTA
TATGGTATTGGCGACTTGTATTCAACTTCTTCGATGATTGTGGGTTACTCGTCTCAGGGCAAGATGGTGGAAGCGAGGAG
GTTGTTTGACTCTTTGTCCGAGAAGAATCTAGTGTTGTGGAATGCAATGTTCTTGGGGTATCTCAAAGTATGTCAACCTG
ATTCCGTCCTTGAACTTGCACGTGAGTTTATAGCCAAGGACAAAGTTACTGATTCTTCGGTCATGGTTAGCATCCTTGGT
GCATGCTCTTTACAAGCTTCAATCGAACCGGGGAAGGAGATTCACTGTCACAGCTTAAGATCAGGGACCTTAATGGATAA
GAAACTTGTGACTGCTTTTGTTGACATGTATTCAAAATGCGGGAACGTTGAGTATGCTGCAAAGGTCTTTGATAGTAGCT
TCGAGAGAGATACAGTTATGTACAACGCTATGTTATCTGGTTATGCTCATCATGGCCATGACGCAAAAGCTTTCAAGCTC
TTTGAAGAGATGACCGAGGCTGGACTCAAGCCGGATGAAATCACTTTTATATCCCTCCTATCAGCTTGTCGTCACAGTGG
CTTAGTTCTAGAAGGTGAGAAGTACTTCAAGTCGATGACAGAGGTTTACAGTATATCCCCCGAGGTTGGTCACTATACCT
GCATCATAGATTTGTATGGAAAGACCAGTAGACTAGACAAAGCCATAGAACTAATGAGAGGTATTGATCAAGTTGAAGAA
GATGCTGTTATTCTTGGAGCGTTTTTAAATGCGTGTAACTTGAATAAGAATACAGAGCTTGTGAAGGAAGTGGAAGAGAA
ACTGTTGGAGATTGATGGATGTAACGGGTCTCGGTATATTCACCTTGCTAACTCTCATGCCTCGTCTGGTAGATGGGATG
AGATGAGACAGATACGGAATCGTATGAGAGGGAAGGAGCTGGGAAAGTTTTATGGGTGCAGCTGGGCGTATATTGATAAT
CAACTTCATATGTTTAGGTCCTCTGATATTTCGCATTTCAGAACTGAAGCTATATATTCTATGCTACATTTTGTGACTAA
GGATTCGACTGAAATGATTGCTTAA