Details for Kale Locus Bo5g116910

Position : C5 ( 5`- 35828427 .. 35829698 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116910

Protein [Map View]
MEKKLTNSNNMSLIRMLRGIICLMVLVSTAFMMLIFWGFLSAVVMRLFSLHYSRKCVYFFFGSWLALWPFLFEKINRTKV
IFSGDKVPCESRVLLIANHRTEVDWMYFWDLALRKGQIGNMKYVLKSSLMKLPLFGWAFHLFEFIPVERKWKVDEANLRQ
MVSSFKDPRDGLWLGLFPEGTDYTEAKCERSKKFAAENGLPILNNVLLPKTKGFVSCLEELGCSLDAVYDVTIGYKTRCP
SFLDNVYGTEPSEVHIHIRRISQNQIPNEEKEINAWLMNTFQIKDQLLGEFYSRGHFPNEGTEKEFSTIKQLINCLAVIG
FTIICTHLTFFSSMIWFKIYVSLVCAYLTYATHFNLRPAPLVETAKKSFQISKKMNF*

DNA
ATGGAAAAGAAACTTACAAACTCTAATAACATGTCTCTGATAAGAATGTTAAGAGGTATCATATGTCTGATGGTGTTGGT
TTCAACAGCTTTTATGATGTTGATTTTCTGGGGGTTCCTATCAGCTGTAGTGATGAGGCTTTTCAGCTTACACTACAGCC
GTAAATGTGTTTATTTCTTCTTTGGCTCGTGGCTCGCCTTGTGGCCTTTCCTCTTTGAGAAGATCAACAGAACCAAAGTT
ATCTTCTCTGGGGATAAGGTTCCTTGTGAGTCACGAGTGTTGCTCATTGCCAATCACCGAACAGAGGTTGACTGGATGTA
CTTCTGGGATCTTGCACTGCGTAAAGGTCAGATTGGGAATATGAAGTATGTCCTGAAGAGCAGTCTGATGAAGTTGCCTC
TGTTCGGTTGGGCGTTTCACCTCTTTGAGTTTATCCCCGTTGAGCGGAAATGGAAAGTAGATGAAGCAAACTTGAGGCAG
ATGGTTTCCAGTTTTAAGGATCCTCGAGATGGTTTATGGCTTGGTCTTTTCCCCGAGGGCACAGATTACACAGAGGCGAA
ATGCGAAAGGAGCAAGAAGTTTGCAGCTGAAAATGGTTTACCCATACTGAACAACGTGTTGCTTCCCAAGACAAAAGGTT
TTGTCTCCTGCTTGGAAGAACTGGGTTGCTCACTTGATGCAGTTTATGATGTGACCATCGGTTACAAAACCCGTTGTCCG
TCTTTCTTAGACAATGTCTATGGTACTGAACCATCAGAAGTTCACATCCACATCCGTCGAATCAGCCAAAACCAAATCCC
AAATGAAGAAAAAGAAATCAATGCTTGGTTAATGAACACATTCCAGATCAAAGACCAGCTGCTCGGTGAGTTCTACTCTC
GTGGCCATTTCCCTAACGAAGGAACAGAAAAAGAGTTCAGCACAATAAAGCAACTGATAAACTGCTTGGCGGTGATTGGG
TTCACTATCATCTGTACGCATCTCACCTTCTTCTCGTCGATGATCTGGTTCAAGATCTATGTCTCTTTGGTCTGTGCCTA
CTTGACCTATGCTACTCATTTCAATCTTCGTCCTGCGCCACTTGTTGAGACTGCAAAGAAAAGCTTTCAAATTAGTAAAA
AAATGAACTTTTAA