Details for Kale Locus Bo5g116900

Position : C5 ( 5`- 35804756 .. 35809578 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116900

Protein [Map View]
MMDIDFDEYKLRCELRGHDDDVRGICVRADEHIATSSRDRTIRVWSLDSDNKRKYSPSKILLGHTSFVGPLAWISPNEEY
PEGRLVSGSMDTSVFVWNLVNGEIVQSLKGHKMQVTGVTLDNQDIVSSSVDQTLKRWRNGQLVESWEAHQSPIQAVLRLP
SGELVSGSSDTTLKLWKGNTSLRTFAGHADTVRGLAVMPDLGFLSASHDGSIRLWALSGEVLLEMVGHTSIVYSVDAHAS
GLIVSGSEDRHAKIWKDGVCVQSLEHPGCVWDAKFLENGDIVTACSDGVARVWTVRDGMIADQMEIDAFDSQLSQYKLSR
KKVGGMKLDELPGLDALTLPGTSDGQTKVVREGDNGVAYVWNMKDQRWDKIGEVVDGPDGVADRSHHGGVQYDFVFDVDI
GDGEPIRKLPYNRSDNPYDAADKWLLKENLPLAYRQQIVEFILQNSGQKDFNFNPSFRDPFTGANAYVPGQSSHAAATTA
KPLYKHIPKRGVLVFDFAQYDGILKKMTEFNNTLRADPVHTDKSLTEVEVSRVGAMVKILKDTSHYHATSFADMDISLIL
KVLQAWPPAMMFPATDLVRMLVLHPHGASLLIKHVEGNNDLLLDLIKKVTEDSALPANLLTTVRVLVNLFKNHSFHYWLQ
RHHSQILDAFSNCYSSPNKNLQLAYSTLLLNYAVLLIEKRDQEGQAQVLSAALQIAEEEAADVDSKFRSLVAIGSLMLEG
LVKKIAIDFEVESIAKSAKESKEAKIVEVGADIDLVIRQP*

DNA
ATGATGGATATCGATTTCGACGAATACAAGCTCAGGTGCGAGCTACGTGGCCACGATGACGATGTCCGTGGAATATGTGT
GCGCGCTGATGAGCATATAGCTACCTCCTCAAGAGACAGAACCATTAGGGTATGGTCACTTGATTCTGATAATAAGCGAA
AGTATTCACCTTCCAAGATTCTTCTGGGTCATACGAGCTTCGTTGGGCCGCTTGCATGGATCTCTCCCAACGAGGAGTAT
CCTGAAGGAAGGCTCGTCTCTGGGAGCATGGATACTTCAGTTTTCGTTTGGAACCTGGTAAATGGAGAGATTGTTCAGTC
ATTGAAGGGTCACAAGATGCAAGTCACTGGTGTTACTCTTGACAACCAGGACATTGTTTCATCTTCTGTTGATCAAACTC
TGAAACGATGGAGAAACGGCCAGCTTGTTGAATCTTGGGAGGCGCACCAGTCGCCTATCCAGGCAGTGTTGAGATTGCCG
TCTGGTGAGCTCGTTTCTGGTTCAAGTGATACCACTCTCAAACTCTGGAAGGGAAACACAAGTCTCCGAACTTTTGCTGG
GCATGCAGACACTGTTAGAGGATTAGCCGTGATGCCTGATTTAGGATTTCTTTCAGCATCACATGATGGCTCAATCAGGC
TCTGGGCTCTAAGTGGCGAAGTTCTTTTGGAGATGGTTGGGCACACCTCCATTGTTTACTCAGTTGACGCTCATGCATCT
GGCCTTATTGTTAGTGGGAGTGAAGATCGCCATGCCAAAATATGGAAAGATGGAGTATGCGTTCAGAGTCTGGAACATCC
AGGCTGTGTCTGGGATGCCAAGTTCTTGGAGAACGGAGACATTGTGACTGCATGTTCAGATGGAGTGGCTCGCGTCTGGA
CAGTACGTGATGGCATGATAGCAGATCAAATGGAGATTGATGCCTTTGATTCCCAACTTTCTCAGTATAAACTGAGCAGG
AAAAAGGTTGGGGGAATGAAACTTGACGAGCTGCCGGGGCTTGATGCTCTGACTTTACCAGGTACCAGTGATGGCCAGAC
AAAAGTCGTAAGGGAGGGAGACAATGGTGTTGCTTATGTATGGAATATGAAGGATCAGAGATGGGACAAAATTGGTGAGG
TTGTTGATGGTCCAGATGGTGTGGCTGACCGTTCTCACCACGGTGGAGTTCAGTATGATTTTGTTTTCGATGTTGACATT
GGTGATGGGGAACCTATCCGAAAGCTTCCTTACAATCGATCAGACAATCCGTATGATGCAGCTGACAAATGGCTTCTAAA
AGAGAATCTTCCCCTCGCATACCGGCAGCAGATTGTTGAATTCATATTACAAAACTCTGGGCAGAAGGACTTCAATTTTA
ATCCATCTTTTCGTGATCCCTTCACTGGCGCAAATGCTTATGTACCTGGGCAATCATCTCATGCAGCTGCAACTACGGCA
AAACCCTTATACAAGCACATTCCAAAAAGAGGTGTACTAGTTTTCGATTTTGCTCAATATGATGGGATCCTGAAAAAGAT
GACAGAGTTCAACAATACTCTACGAGCTGATCCAGTACATACTGACAAATCCCTGACAGAAGTTGAAGTATCCAGAGTAG
GCGCAATGGTGAAAATACTCAAGGACACCTCACATTACCATGCTACTAGTTTTGCTGACATGGATATTTCTTTGATTTTG
AAAGTGTTACAAGCATGGCCACCTGCGATGATGTTTCCTGCTACCGATTTAGTCAGGATGCTCGTTTTGCATCCTCATGG
AGCAAGTCTACTTATCAAGCATGTGGAAGGCAACAATGATCTGCTTCTGGATCTTATAAAGAAAGTCACAGAAGATTCGG
CTCTTCCTGCAAATCTTCTAACAACTGTTCGTGTACTTGTTAATCTATTCAAAAATCATTCATTTCATTACTGGCTACAG
AGGCATCATAGTCAAATTCTTGATGCCTTCTCAAACTGTTATTCATCCCCAAATAAGAACCTGCAGTTGGCATATTCGAC
ATTGCTTCTCAATTATGCAGTGCTATTAATAGAAAAGAGGGATCAAGAAGGCCAAGCTCAAGTCCTTTCAGCAGCATTGC
AGATTGCAGAAGAGGAAGCTGCAGATGTTGATTCTAAGTTCCGGAGTTTGGTAGCAATCGGCTCGCTGATGCTTGAAGGC
CTGGTGAAGAAGATAGCAATAGATTTTGAGGTGGAGAGCATTGCGAAATCAGCAAAGGAATCTAAGGAAGCTAAGATTGT
GGAAGTTGGTGCTGATATCGATCTTGTAATTCGCCAACCTTAG