Details for Kale Locus Bo5g116880

Position : C5 ( 5`- 35800840 .. 35801667 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116880

Protein [Map View]
MATVTASLRLQPLSSLSSSSSPPPSSRPLYLKFNTSHRENLRYLSSLGVIPQNPRLAPPVDNLPHILSAVNFLKSKGISD
EDFPRLVYLCPQLFSPTFSISETDPVFDFLAGELGASAAESRGLIVNCPSILLSDVEYCLRPTLVYLKELGVKNLNRASK
TNAHVLNTRAEKLRAKMRFLKSIGFEHEEAARVCGRIPAIFGYSVEDNLRPKFEFLVYDMERELEELKKFPQYFGFSLGK
RIKPRHWHLKKKGVRLSLSRMLMWGDHKFYSKWKP*

DNA
ATGGCTACTGTAACCGCTTCGCTTCGTCTTCAACCTCTATCATCACTCTCCTCGTCTTCCTCTCCTCCTCCAAGCTCTAG
ACCTCTCTATCTCAAGTTTAATACCTCGCACCGCGAAAACCTAAGATACCTCTCGTCTCTCGGAGTAATCCCTCAGAATC
CAAGACTCGCTCCTCCGGTGGACAACCTCCCTCACATCCTCTCCGCCGTGAACTTCCTAAAATCAAAAGGAATCTCCGAC
GAAGACTTCCCTCGCCTCGTCTACCTCTGCCCGCAGCTCTTCTCACCGACTTTCTCCATCTCCGAAACAGATCCCGTCTT
CGACTTCCTCGCCGGCGAGCTCGGAGCCTCCGCCGCGGAATCCAGAGGACTGATCGTGAACTGCCCCAGCATCCTCCTCT
CCGACGTGGAGTACTGTTTGAGACCGACGCTGGTTTACCTCAAGGAGCTGGGGGTGAAGAATCTGAACAGAGCGAGCAAG
ACGAACGCGCACGTGCTCAACACGAGGGCGGAGAAGCTGAGAGCGAAGATGAGGTTCCTCAAGAGCATAGGGTTTGAGCA
CGAGGAAGCGGCGAGAGTGTGTGGGAGGATCCCGGCGATATTTGGGTACAGTGTGGAGGATAACCTGAGGCCCAAGTTTG
AGTTTCTGGTTTATGATATGGAGAGAGAGTTGGAAGAGTTGAAGAAGTTTCCTCAGTATTTTGGGTTTAGCTTGGGGAAG
AGAATAAAGCCGAGGCATTGGCATTTGAAGAAGAAAGGCGTTAGGCTTTCGCTTAGTAGGATGTTGATGTGGGGTGATCA
CAAGTTCTATTCCAAGTGGAAACCATGA