Details for Kale Locus Bo5g116860

Position : C5 ( 5`- 35794922 .. 35798204 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116860

Protein [Map View]
MEGTSFLRGQPLTTAPSLPRQRFLLQGWKNNRIVRFSGLTNHSDSIKSRSFFDLSLRASDKAPIKASSAVTEANPTNLES
KEQDLVFVAGATGKVGSRTVRELLKLGFRVKAGVRSAQRASSLVQSVKDMNTDEGTQQEKVTGSVCVFSPAVEKLEIVEC
DLEKKDSIQPALGNASVVICCIGASEKEISDITGPYRIDYLATKNLVDAATSAKVNNFILVTSLGTNKFGFPAAILNLFW
GVLCWKRKAEEALIASGLNYAIVRPGGMERPTDAYKETHNLTLALDDTLFGGQVSNLQVAELLACMAKNPQLSCSKIVEV
VAETTAPLTPIEKLLEKIPSKRPYVPPPKESVPAKEVTPVPAEPVKQESVAAKEVTPVLTEPVTKEPTAPKEDKAPAEVK
DVKPRPLSPYAAYEDLKPPTSPIPATALGATKAKEVDATQVPEVEETQVPVEANAVPPPESPVETSVPVVEEVKQVEEKK
ERPLSPYASYENLKPPSSPTPKACGIQKSDTLAPVPTDSDTGESSTVATTVTEEAEAPPAIPKMRPLSPYAAYADLKPPT
SPTPASTGPKKTAPAEEISEVPGGNDVVETVDGSVITTESASVPEAETVNSVTDTSLTPEESAADQPKPRPLSPYTMYED
MKPPTSPLPSPVINH*

DNA
ATGGAAGGAACTAGTTTTCTCCGAGGGCAACCTCTAACAACAGCACCCTCCCTTCCCAGACAAAGGTTCCTTCTCCAAGG
ATGGAAAAACAATCGGATTGTCAGGTTTTCTGGTTTGACGAATCACTCCGATTCTATAAAGTCCAGGTCTTTCTTCGATC
TTAGCCTCAGAGCTTCAGACAAAGCTCCCATAAAGGCAAGCTCTGCCGTAACAGAGGCAAACCCTACGAACTTAGAATCA
AAGGAACAAGACCTTGTCTTTGTAGCTGGTGCTACGGGTAAAGTTGGTTCTAGAACTGTGAGAGAGTTACTGAAGCTCGG
ATTTCGAGTTAAAGCTGGAGTTCGAAGCGCTCAGAGAGCATCAAGTCTTGTGCAAAGTGTTAAGGATATGAACACAGATG
AAGGAACTCAACAAGAAAAGGTAACAGGCAGTGTCTGTGTCTTTAGCCCAGCTGTAGAAAAGCTTGAGATTGTTGAATGT
GACTTGGAGAAGAAAGACTCAATACAGCCTGCATTGGGGAATGCATCTGTGGTTATATGCTGTATAGGTGCTAGCGAGAA
AGAAATATCCGATATCACCGGTCCTTACAGGATTGATTATTTGGCCACCAAAAACCTTGTTGATGCTGCAACATCTGCAA
AAGTTAATAACTTCATCTTGGTGACATCCTTAGGGACCAATAAATTTGGATTTCCCGCTGCCATTCTCAATCTGTTCTGG
GGAGTTCTTTGCTGGAAGAGAAAAGCTGAAGAAGCCTTGATTGCAAGTGGTCTCAACTACGCAATAGTTAGGCCTGGAGG
AATGGAGAGACCAACTGATGCATACAAGGAGACTCATAATCTCACTCTTGCTCTAGATGATACATTGTTTGGTGGTCAGG
TCTCAAATCTCCAGGTTGCAGAATTGCTAGCTTGTATGGCTAAGAACCCTCAACTTTCTTGCTCTAAGATTGTGGAAGTG
GTTGCTGAAACAACTGCACCATTAACCCCTATTGAAAAGCTTCTTGAAAAGATTCCTTCCAAACGTCCTTATGTGCCTCC
ACCAAAGGAATCAGTTCCAGCCAAAGAGGTAACACCAGTTCCTGCTGAGCCTGTCAAGCAAGAATCAGTTGCAGCCAAAG
AGGTAACACCAGTCCTTACTGAGCCTGTCACTAAAGAACCAACAGCTCCCAAGGAGGATAAAGCACCTGCAGAAGTGAAA
GATGTTAAGCCTAGGCCGCTGTCTCCTTATGCCGCCTATGAAGACTTGAAACCTCCAACATCTCCTATTCCGGCCACAGC
ACTTGGTGCCACCAAAGCTAAGGAGGTGGATGCAACTCAGGTTCCGGAGGTGGAAGAAACTCAGGTTCCTGTTGAGGCTA
ATGCAGTTCCACCACCAGAAAGTCCTGTTGAGACCAGTGTCCCAGTAGTAGAAGAAGTGAAGCAAGTTGAGGAAAAGAAA
GAGAGGCCTCTTTCTCCTTATGCTAGCTATGAGAATCTAAAACCACCTTCATCTCCCACTCCTAAAGCTTGTGGTATCCA
GAAGAGCGATACTTTGGCGCCTGTTCCAACAGATTCTGATACTGGTGAAAGCTCAACAGTTGCAACAACTGTCACTGAGG
AGGCAGAAGCACCACCAGCCATACCAAAAATGAGACCTCTTTCTCCTTATGCAGCTTACGCAGACCTAAAACCACCAACC
TCACCGACTCCTGCATCAACTGGTCCCAAGAAAACAGCACCTGCAGAAGAAATCTCAGAGGTACCTGGAGGCAATGACGT
GGTGGAAACAGTTGATGGTAGTGTGATCACGACTGAATCTGCTTCTGTGCCAGAGGCGGAAACCGTTAACAGTGTGACAG
ACACTTCCCTTACCCCAGAAGAAAGTGCAGCTGATCAGCCAAAGCCAAGGCCATTGTCACCTTACACAATGTATGAGGAC
ATGAAGCCTCCAACATCACCTCTTCCATCTCCGGTCATCAATCATTAG