Details for Kale Locus Bo5g116850

Position : C5 ( 5`- 35792681 .. 35793931 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116850

Protein [Map View]
MRFAAPPPRSGDISPSPSPAASPSLSPYSGVPEEILSPSSDPPLQFSPPLIAMVVVLAAAFLFVTYSRLISRRFLSPLFR
RFRRWRHRRRRLLHLSSASNSSSDLRSFSPFPFDSFHYSSYSPYGLDESVIKTLPLFLYSAASCTGKSLSPATAVGKTPA
TAVDCAVCLLEFEEGDYVRTLPLCFHAFHLECIDEWLRSHPNCPLCRTAILRSGVVATTSPFVPLMAPRIRPSLDEESNA
IVIRSETPPRSNDNLNIAATVTDDQEITAAVEEQTPAISRFRELKRSYSFDYDREESASERVTMEPATVSPWRYRRSTWN
KQRQSPFGNLKSRVFSLRYHRSAKSPFSRRRSGVFFPISERIPATGSSSSRRTKSMTSPRFFRTAPHSSSRLRCGDPEAL
LSPERWRRKDTCRLDM*

DNA
ATGCGATTCGCGGCACCACCGCCGCGTTCCGGCGATATCTCACCTTCTCCTTCGCCAGCTGCTTCACCGTCTCTTTCACC
GTATTCAGGAGTACCAGAGGAGATTCTTTCTCCTTCTTCTGACCCTCCTTTACAGTTTAGCCCTCCGTTGATCGCCATGG
TGGTGGTTTTAGCCGCCGCTTTTCTTTTCGTGACCTACTCTCGCCTCATCTCCCGCCGATTCCTCTCGCCTCTCTTCCGC
CGTTTTCGACGGTGGCGACATCGTCGGCGCCGTCTCCTCCACCTATCCTCTGCTTCAAACTCGTCCTCCGATCTCCGATC
CTTTTCCCCTTTCCCTTTCGACTCGTTTCACTACTCCTCCTACTCTCCTTACGGACTAGATGAGTCCGTTATCAAAACTC
TGCCTCTGTTTCTCTACTCCGCCGCCTCTTGCACCGGGAAGAGCCTTTCTCCTGCCACCGCGGTGGGGAAAACTCCAGCC
ACCGCCGTGGACTGCGCCGTTTGTTTGTTGGAGTTCGAGGAAGGAGATTACGTGCGGACGCTTCCGTTGTGCTTCCATGC
TTTCCACCTTGAGTGCATCGATGAGTGGCTTCGATCTCACCCTAACTGTCCCCTCTGCCGTACTGCGATTCTCCGATCCG
GCGTCGTTGCGACTACCTCGCCGTTCGTTCCCTTGATGGCTCCTAGAATCCGTCCAAGCCTCGACGAAGAGAGTAACGCG
ATCGTCATCCGCAGCGAAACTCCGCCGCGGAGTAATGATAATTTAAACATAGCCGCGACGGTTACAGACGATCAGGAGAT
CACAGCGGCGGTGGAAGAGCAAACGCCGGCTATTTCTCGGTTCCGGGAGCTGAAGAGATCCTACTCGTTTGATTACGATA
GGGAGGAATCAGCATCAGAGAGAGTGACGATGGAGCCAGCCACGGTGTCTCCGTGGAGATACCGGAGATCCACGTGGAAC
AAGCAGCGTCAGTCTCCGTTCGGAAACCTGAAATCGAGAGTGTTCTCGTTACGTTACCACAGAAGCGCGAAATCACCGTT
TTCGCGGCGGCGATCGGGAGTGTTCTTCCCGATATCAGAGCGGATTCCGGCGACGGGAAGCTCATCGTCGCGGCGGACGA
AATCGATGACGAGTCCGAGGTTCTTTAGAACGGCACCGCACTCGTCGAGCCGGTTAAGATGCGGAGATCCAGAGGCACTG
TTATCGCCGGAGAGGTGGAGGAGAAAGGACACGTGTAGGCTAGATATGTAA