Details for Kale Locus Bo5g116830

Position : C5 ( 5`- 35783313 .. 35785079 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116830

Protein [Map View]
MEFVVEEGKRVHEECPTLILPALSIGNVGQLAVDLLVSSTAAERVGYLDDLNLLPCVGNDAYGPLPCGDLALPLEVYESS
STAITLAQQRSPVAKGMMIKFAENIAEFAASSGKKDVIVLSSLDFQRLHNLDLSRGPQVYYLSNTESDGRDDHCERLGFG
RLGEFDSEGRCWKYLSSVFDKNSKEDLTFPSEDELEDIDYYPSLPFAALFSAFKARGLKVTCLLCYCSEGDNIPDAFLLA
EAASKLTGLTPDKFHGEEGGKWRIPYSWKSMYGAPPDMSMF*

DNA
ATGGAGTTTGTAGTTGAAGAAGGAAAGCGAGTCCATGAAGAATGCCCGACTTTGATTCTACCTGCATTGTCAATTGGGAA
CGTAGGGCAGCTGGCTGTTGATCTTCTAGTGTCATCTACTGCTGCAGAGAGAGTTGGTTATCTCGATGATCTCAATCTGC
TTCCTTGTGTTGGCAACGACGCATATGGCCCTCTCCCTTGTGGTGATCTCGCTCTTCCCCTCGAAGTGTATGAGTCATCT
TCAACTGCTATTACTCTTGCTCAGCAACGGTCTCCTGTTGCAAAGGGAATGATGATTAAATTTGCGGAGAATATAGCAGA
GTTTGCTGCTTCAAGTGGAAAGAAGGATGTTATTGTGCTTTCTAGTTTAGACTTCCAGAGGCTGCACAACTTGGATTTGT
CAAGAGGCCCACAGGTGTATTATCTGTCTAACACCGAATCTGATGGAAGAGATGATCACTGTGAAAGGCTCGGGTTTGGA
AGATTGGGCGAGTTTGATTCGGAAGGAAGATGTTGGAAGTATCTTAGCTCTGTCTTTGACAAGAACAGTAAAGAAGATCT
GACTTTCCCTTCGGAAGATGAGCTTGAAGACATAGACTACTACCCAAGCTTGCCATTTGCAGCTCTCTTCTCAGCTTTTA
AGGCAAGAGGCTTGAAGGTGACATGTCTGCTATGTTACTGTTCTGAAGGAGACAACATTCCTGATGCATTCCTTCTAGCA
GAGGCTGCTTCTAAGCTTACGGGTTTAACTCCTGACAAGTTCCATGGGGAAGAAGGTGGGAAGTGGCGGATACCGTATTC
ATGGAAGAGTATGTACGGAGCTCCTCCTGATATGTCCATGTTTTAA