Details for Kale Locus Bo5g116820

Position : C5 ( 5`- 35770597 .. 35771718 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116820

Protein [Map View]
MSPSPWNQTYSPYYKSPWIYQTTPNVDDDSDNGLIGTIVRQEGHVYSLAASGDLLFTGSDSKNIRVWKDLKDFAGFKSTS
GSVKAIVITGNNRIFTGHQDGKIRIWRGSKKRTGVYPRIGSLPSTKQFLTKSVNPKNYVEVRRHKNVLKIRHYDAVSCLS
LNEELGLLYSGSWDKTLKVWRLSDSKCLESIQAHDDAVNTVAAGFDDLLFTGSADGTLKVWKRELQGKRTKHFLVNVLMK
QENAVTALAVNLTACVVYCGTSDGSVNFWEGKNNLSHGGILRGHRMAVLCLAAAGSLVLSGGADKNICVWRRNGDGSHSC
LSVLMDHVGPVKCLTAVEEAEKDSNGRWIVYSGSLDKSVKVWRVTETAPPVIG*

DNA
ATGTCTCCATCTCCGTGGAACCAGACTTACTCTCCGTATTACAAGTCTCCTTGGATCTACCAGACGACCCCAAACGTGGA
TGATGATTCAGACAACGGTTTGATCGGTACGATCGTAAGGCAAGAAGGTCATGTATACTCGTTGGCTGCTTCAGGAGATC
TTCTATTCACCGGATCCGATTCCAAGAACATTCGGGTCTGGAAAGATCTCAAGGACTTCGCCGGTTTTAAATCAACCAGT
GGTTCAGTTAAAGCGATTGTGATAACCGGAAATAACCGGATTTTTACCGGTCATCAAGACGGTAAAATCCGAATTTGGAG
AGGGTCTAAGAAAAGAACCGGAGTATATCCACGAATCGGGAGCTTACCGAGTACGAAGCAGTTTCTGACCAAATCCGTGA
ACCCGAAGAATTATGTCGAGGTACGTCGCCATAAAAATGTTTTGAAGATACGACACTACGACGCCGTTTCGTGTCTAAGC
TTGAACGAGGAGCTCGGTTTACTCTACTCCGGTTCGTGGGACAAGACTCTCAAAGTCTGGAGACTCTCCGACTCGAAATG
CCTAGAATCGATTCAAGCTCATGACGACGCCGTCAACACCGTAGCCGCCGGGTTCGACGACTTGCTGTTCACCGGCTCCG
CCGACGGAACTTTGAAAGTGTGGAAACGCGAGCTTCAAGGGAAAAGGACGAAGCATTTCCTCGTAAACGTGTTGATGAAG
CAAGAGAACGCCGTGACGGCGTTAGCGGTTAACTTAACGGCGTGTGTTGTTTACTGTGGAACTTCTGACGGTTCCGTTAA
TTTTTGGGAAGGGAAAAATAATCTTTCTCACGGCGGGATTCTCCGCGGCCATCGTATGGCGGTGCTCTGCCTCGCCGCCG
CCGGGAGTCTGGTACTGAGCGGCGGAGCGGATAAGAACATTTGCGTGTGGAGGAGGAACGGCGATGGGAGTCACTCGTGT
CTCTCGGTGTTGATGGACCACGTGGGACCCGTCAAGTGTTTGACGGCGGTGGAAGAGGCGGAGAAAGATAGCAACGGAAG
ATGGATAGTGTATAGTGGAAGCTTGGATAAATCGGTGAAAGTGTGGCGCGTGACGGAGACTGCGCCTCCGGTGATTGGCT
GA