Details for Kale Locus Bo5g116800

Position : C5 ( 5`- 35762477 .. 35763880 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116800

Protein [Map View]
MSSVFPGPRFLSLLHKNSKTLVQAKQIHAQLVIHGCQDNSLVGKLIGHYCSKQSTESSKLAHSLVFPRFSHPDKFLFNTL
LKCSNPEDSIRIFTNWLSKSSLLYLNERTFVFLLGACARSASSSRVGRIVHGMVIKLGFLYKSELIGTTLLHFYAKHGDI
RYARKVFDEMPERTSVTWNAMIGGYCSHKDKGNHSARKGMILFRRFSYFGDGVSRPTDTTMVCVLSAISQMGLLEVGALV
HGYIEKLGFTPEVDVFIGTGLVDMYSKCGCLNSAISVFELMRAKNVLTWTSMATGLALNGRGNETPSLLNRMAESGIKPN
VVSFTSLLSAYRHNGLVQEGLELFQSMRARFGVTPIIQHYGCIVDLLGKAGRLQEAYEFVLAMPINPDAIMLRSLCNACS
IYGETVMGEEIGKALIKMELEEKGDESEDYVALSNVLASKGKWVEVEKLRDEMKARRIKTRPGYSFV*

DNA
ATGAGCTCTGTTTTCCCTGGACCAAGATTCTTGTCCTTGTTGCACAAGAACTCGAAAACCCTAGTTCAGGCTAAGCAAAT
CCATGCTCAACTCGTGATTCACGGATGCCAAGACAATTCTCTCGTCGGCAAACTCATAGGCCATTACTGTTCGAAGCAAT
CTACAGAAAGCTCCAAGCTTGCTCATTCACTAGTGTTCCCTCGTTTTAGTCATCCTGACAAGTTTCTATTCAACACATTG
CTTAAATGCAGCAACCCAGAAGACTCTATACGGATCTTCACCAACTGGTTATCAAAAAGTTCGTTGCTTTATCTCAACGA
GCGCACGTTCGTCTTCCTCCTCGGCGCTTGCGCCAGGTCGGCTTCTTCGTCGCGTGTCGGGAGGATCGTTCACGGGATGG
TGATAAAGCTTGGGTTTCTCTATAAATCTGAGTTGATTGGAACCACTTTGCTCCATTTCTATGCCAAGCATGGGGATATA
CGGTATGCTCGGAAAGTGTTTGATGAAATGCCTGAGAGAACTTCAGTTACATGGAACGCAATGATCGGAGGGTACTGTTC
GCATAAGGACAAAGGGAATCACAGTGCGAGAAAAGGGATGATTCTGTTCCGGAGATTCTCCTACTTTGGTGATGGAGTTA
GTAGACCTACTGATACAACCATGGTTTGTGTTCTTTCAGCCATCTCTCAGATGGGTTTGCTCGAAGTTGGTGCTCTTGTT
CATGGATACATAGAGAAACTTGGTTTCACGCCCGAAGTTGATGTCTTTATCGGTACTGGACTTGTTGACATGTACTCCAA
ATGCGGCTGCTTAAACAGTGCTATCTCTGTGTTCGAGCTAATGAGAGCGAAGAATGTTTTGACATGGACCTCAATGGCGA
CGGGGCTAGCTCTCAACGGAAGGGGGAACGAAACACCGAGTCTTCTAAACCGAATGGCGGAGTCTGGTATCAAACCAAAC
GTAGTATCTTTCACTAGTTTGCTTTCGGCTTACCGTCATAACGGTCTTGTTCAAGAAGGACTGGAGTTGTTTCAGAGCAT
GAGGGCAAGGTTTGGTGTGACTCCGATTATTCAACACTACGGATGCATAGTAGATCTTCTCGGCAAAGCAGGGCGGTTAC
AAGAAGCGTATGAGTTTGTGTTAGCTATGCCTATCAATCCCGACGCTATCATGTTGAGAAGTCTCTGCAATGCCTGCAGC
ATCTATGGAGAGACTGTGATGGGTGAAGAGATCGGAAAAGCTCTTATCAAGATGGAATTAGAGGAGAAGGGTGATGAAAG
CGAAGATTATGTTGCTCTGTCTAATGTGTTAGCTTCTAAAGGGAAATGGGTAGAGGTAGAGAAGCTGAGGGATGAGATGA
AAGCAAGAAGGATCAAAACAAGACCTGGTTACAGCTTTGTTTAG