Details for Kale Locus Bo5g116790

Position : C5 ( 5`- 35757065 .. 35761491 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g116790

Protein [Map View]
MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNNKIWFQDGWQEFVDRYSIRIGYL
LIFRYEGNSAFSVYIYNLSHSEINYHSSALMDTAHTHLKRARLFEDLEDEDAAEVVYPSSSVYPSSQQHPEVTVAAIKGY
ASPAIQSFFAGPPVKAEEATPTPKVTKKRGRKKKNAVPEEVNSSAPRDDDPESRSKFYESASARKRTVTAEERERAINAA
KTFEPTNPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLGEKQWPVRCLYKAGRAKFSQGWYEFTLENNLGE
GDVCVFELLRTRDFVLKVTAYRVNAI*

DNA
ATGCCACGCCCTTTCTTCCACAAGTTGATTTTCTCATCCACTATCCAAGAAAAACGCCTGAGAGTTCCAGATAAGTTTGT
GAGTAAATTCAAGGACGAGCTATCCGTCGCAGTTGCACTCACGGTACCTGACGGCCACGTTTGGCGTGTAGGACTAAGAA
AAGCCGACAACAACAAAATCTGGTTTCAAGATGGTTGGCAAGAGTTTGTCGACCGTTACTCAATCCGCATTGGCTATCTC
CTCATCTTCAGATACGAAGGCAACTCTGCCTTCAGCGTCTACATATACAACTTATCACACTCCGAGATCAACTACCATTC
CTCCGCTCTCATGGACACCGCACACACCCACCTCAAACGCGCCCGTTTGTTTGAAGATCTTGAAGACGAAGACGCTGCCG
AGGTTGTTTATCCTTCTTCCTCAGTGTATCCGTCATCACAACAGCATCCTGAAGTTACTGTAGCCGCTATTAAAGGGTAC
GCTAGCCCAGCTATCCAGAGCTTCTTCGCTGGACCACCTGTTAAAGCTGAAGAGGCGACACCGACCCCTAAAGTTACTAA
GAAGAGAGGGAGGAAGAAGAAGAACGCTGTTCCTGAGGAAGTAAACTCATCTGCTCCGAGGGATGATGACCCGGAGAGCC
GTTCAAAGTTCTACGAGAGTGCTTCTGCGAGAAAGAGAACGGTGACTGCAGAGGAAAGAGAGAGGGCCATTAATGCAGCC
AAAACGTTCGAGCCAACAAACCCTTTCTTCAGAGTTGTTCTTCGACCATCTTATCTATACAGAGGCTGCATCATGTATCT
GCCTTCTGGTTTTGCTGAGAAGTACTTAAGTGGGATCTCGGGATTCATCAAGGTCCAGCTCGGGGAGAAACAGTGGCCGG
TGAGATGCCTCTACAAAGCAGGGAGAGCCAAGTTCAGCCAAGGGTGGTACGAGTTCACCCTGGAGAACAACCTAGGAGAA
GGTGACGTCTGCGTGTTCGAGCTCCTCAGAACCAGAGACTTCGTCCTGAAAGTAACGGCCTATCGGGTCAACGCAATCTA
G