Details for Kale Locus Bo5g115730

Position : C5 ( 5`- 35705693 .. 35705875 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115730

Protein [Map View]
MVSQKLEICIELVKIGVVFVATVAGSVEKAFRKPPPSLPAVHDSRRNSYADVPIPLVGFM*

DNA
ATGGTGTCTCAAAAGCTAGAGATCTGCATCGAATTAGTGAAGATTGGCGTCGTTTTTGTCGCCACTGTGGCTGGATCAGT
AGAAAAAGCTTTCCGTAAGCCACCACCGTCGCTTCCGGCAGTTCATGATAGTCGCCGGAACAGTTACGCCGACGTTCCTA
TTCCTCTCGTTGGATTCATGTGA