Details for Kale Locus Bo5g115700

Position : C5 ( 5`- 35671031 .. 35682545 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115700

Protein [Map View]
MLRDAKLSRRDSGKHEEIENVPENLQASFLSQTSNDSSSSSSSISLPRAPLNTIHDPLKDSRSSKMDRTPSKPKPKNPDP
ALPLRTPDNNKHRFGWGERRGSIANTTPKTGRVVGRANSETGSAQNTPTKSVSKPPPGSCYRGKIDGAGRAGGYASLYKG
LSSSDRQVSGVVNTVEVPHFDLKEDPSFWMDHNVQILIRVRPLNSMEKSINGYSRCLKQESSQCVAWTGQPETRFLFDHV
ACETIDQETLFRVAGLPMVENCLSGYNSCIFAYGQTGSGKTYTMLGEVGDLEVKPSPNRGMMPRIFEFLFARIQAEEESR
RDESLKYNCKCSFLEIYNEQITDLLEPSSTNLQLREDIKSGVYVENLTEFEVESVQDILGLITQGSMNRKVGATNMNRES
SRSHSVFTCVIESRWEKDSTTNMRFARLNLVDLAGSERQKTSGAEGDRLKEAANINKSLSTLGHVIMVLVDVANGKPRHI
PYRDSRLTFLLQDSLGGNSKTMIIANASPSVSCAAETLNTFKFAQRAKLIQNNAVVNEDFNGDVLELRRQIRLLKEELSL
LKRQNISRALSFGTATANITEFQVDSPSNELPERGHQQARNSLVYESGGCVRMSRKQLKSLEITLAGSLRREHVADASIK
NLEAEIEHLNRLVRQREEDTRSTKMMLRFREDKIQRLESLLGNHISADSYLLEEKNVLSEEIQLLQAKIDKNPELTRFAL
ENIRLLDQLRRFQEFYEEGEREILQGEVSNLRNQLVQFLDENADRQKHPDDVTEPQDALRISKENYSLQEELKKTSNELE
KCRSKLGSCLEENAKLSREIHDLQAMVSDIRASTPDEHSSNKQKALLETQNADRPETLAGQQVNHVEEIIKLQLDLDVLK
IILDEERTLRGDTEAQAVLLKLNIGELKDQLLLMSKQQENVNSELRETKSVVEALESQNSILIQEAVELRRTKEKYTELL
QKQELDIPATKSKQCNEFKDNPAEDNAINAKFKKMQASLEKAKRLNMLFKNDIASKACGDEETDEVQRQAEAETAEVIVY
LQNELEVLQKEVDDFQSKENVTEQQVKLLETHMEELQDNLRDMTMDNEQLQENLRSKEMELQIISNEMELLTSELEEILL
SGNEGLTDACYQADLISDSFPDKRIWISEQVGELIRTISERESVIEDLESCLEDANKKQCDIESMLKSLRGAALVMSEAH
QREYEEKETHTLLLKSQLCKKAEAMSRLLEKLKMAESWIYEASHCATASLVIVNRYSEIIESHTFELKQKDLQLEESAGT
VLSLNQQVQDLEATCEEFRSKLLEEAKNASAMERKLEEIEETGISAMKEKLSELKGGVSGLRSCINMCQEHEKYTEAEKS
LGSPAHCSEEQENGRNVVVSSCIEKTPTKNHSEPMRASSQVSTERGKVIILLKQEMESALVSLKEVQFEMARLQEEKEEL
KASEKRSLSNLHDLAAQFSNLETVMNRMKEQNENKMEATDHKLETLEHELAKMKLEAGQGHVENLCVLQKFEEAQWTIKE
ADIMINELIIAKEMMKLDLEKQKKKERSLVGERNALVDKLQELESINVKENEKVEYLEKLFESSLMGVGDLVEELETVVR
KLQDESSEALTGMANDLSDLKSSVSETKSARLFLEDIWSEIIMKDCALSVLHLCHMGVLLETVTGVNAENGLLHRGLCES
NSSIAGLRDNNVRLRRELEMFTTLKGKLLADIKNGFERVSRNEEATNLLTTKLSNFEQKISGLQYQEELMLQRSDSMGSQ
LDILMKEIDLSNGNLAETLLEQKLHLNQKSDFFDTEVQHYLMDLCSKDVESLVLALKVKECSSCLAILDKELLDHQAFVE
DLKEKLFVSQVESELKDLCLVDNKLETVSDKQKLTEAQRKIKVLSSDLKHSVQKTVEMDEANKAFGERVFFLESRVSDLQ
QDLERKDFELQSLQHSQSIAAGELGIKERDIQVYADAVSALKNENSSLKHTFMHFGEDQSKALNVNSISIAKCSEGSRTL
EKLTRDGLVFSDQMFELMCENANKASEFADTVQSLQIDVEDLLSENLNLQDELLRKDDVLKGLSFDLSLLQESASNSRDK
EDETKEIMVHVEALEKTLASRTSELEEAVSFAQMLEVQLQGSKEIICNLEKDTEKAMQCREQLAAENEEIRAEAEDLLAE
KSSLEEELIQTKKVSESMEMELFNLRNALGQLNDKVESTQSKLDETIDERDNLQDEVLYVTEERGKMKAEAKELEVRIIE
AQEIAESRKMYADQREEEVKLLEGSVEQLEYTIDALENKVNVIKDEAERQRLQREELETELHTIRQQMESVRNADEEMKR
ILDEKHMDLQEAQKHIEALERKTANQMTEITQLSAHISELNMHAEAQAREYMHKVKELEAMAEQVKPEIHVSQAVDSSLS
KGSGKPRGSGSPFRCIGLGLAQQMRSEKDEELAAARQRVEDLETVVATKQKEIFLLNSKLAKVDSMTHDITRVMLGLKQN
CASLLDSQQVSKIAEMLQRYSSDSRETDFEVSQLKRQLSEYNEERQGWLEEIEGKQSDLVTAQIELEEHRQHEQLLKKEN
EFLKEENNVLKLQLDELNLKLRRADVNISRAKEELAWYRASTGKNQHSNFEKMHHLSTKLKESEEERMQLGKQLLCLSTS
ILKAAGVTGEDITDINPEVAEEALEQLKTRVGLLESELDHFRLKGKTKSRRSRNPERAMPSMPSPRRKSWSQSPRKMSQV
PFFTSVDR*

DNA
ATGTTAAGGGACGCTAAGTTATCCCGTAGAGACTCAGGCAAGCACGAGGAGATCGAGAACGTCCCCGAGAATCTCCAAGC
TTCCTTCTTGTCTCAGACCAGCAACGACTCCTCTTCTTCCTCCTCCTCCATCTCTCTACCACGAGCTCCTTTAAACACGA
TCCACGATCCGTTGAAGGATTCCCGGAGTAGTAAGATGGATCGAACTCCGTCTAAGCCCAAACCCAAGAACCCAGATCCA
GCATTGCCTTTACGGACGCCTGATAACAACAAGCACCGGTTCGGTTGGGGCGAGAGGCGTGGCTCTATCGCTAACACGAC
TCCTAAGACCGGTAGAGTTGTCGGGAGAGCTAACTCCGAGACCGGTTCGGCTCAGAATACGCCTACAAAGAGCGTGTCTA
AGCCTCCGCCGGGGTCTTGTTACAGAGGGAAGATTGATGGGGCGGGCAGAGCTGGTGGGTATGCGTCGTTGTACAAAGGG
TTGTCTAGCTCTGATAGGCAAGTTTCTGGTGTTGTTAATACCGTTGAAGTTCCTCACTTTGACCTTAAGGAGGATCCTTC
TTTCTGGATGGATCACAATGTGCAGATTCTTATACGTGTACGACCGCTTAATAGCATGGAGAAGAGTATTAATGGGTACA
GTAGGTGCTTAAAGCAGGAAAGCTCGCAATGCGTAGCGTGGACTGGGCAACCAGAAACACGGTTTTTATTTGATCATGTG
GCTTGTGAGACGATTGACCAGGAAACCCTTTTTCGGGTTGCAGGTCTGCCCATGGTGGAAAATTGCTTGTCTGGCTACAA
CAGCTGTATCTTTGCGTATGGCCAGACAGGAAGTGGAAAAACATATACAATGCTTGGGGAAGTTGGTGATTTAGAAGTTA
AACCAAGTCCCAACAGAGGAATGATGCCACGGATTTTTGAATTTTTGTTTGCAAGAATACAAGCTGAGGAAGAGAGCAGA
AGAGACGAGAGCCTTAAATACAATTGCAAATGCTCTTTTCTTGAGATTTACAATGAACAGATCACTGACCTTCTTGAACC
GTCTTCAACAAATTTGCAGCTTCGAGAGGACATTAAGAGCGGTGTCTATGTGGAAAATCTCACTGAGTTTGAAGTAGAGA
GTGTTCAAGACATCTTAGGGCTTATCACACAGGGTTCTATGAATCGAAAAGTTGGAGCCACAAATATGAACAGAGAGAGC
AGCAGATCACATAGTGTATTTACATGCGTGATCGAGAGCAGATGGGAAAAAGACTCGACAACTAATATGCGTTTTGCAAG
ACTGAACCTGGTTGACCTTGCTGGATCAGAGAGGCAAAAAACTTCTGGCGCTGAGGGTGACCGCCTAAAAGAAGCTGCTA
ACATCAATAAGTCATTGTCCACACTAGGACATGTCATTATGGTTCTTGTGGATGTTGCAAATGGTAAACCAAGGCATATT
CCATATCGTGATTCAAGGCTGACATTTCTTCTTCAGGACTCACTGGGTGGCAATTCAAAAACGATGATCATTGCTAATGC
TAGTCCTTCCGTCAGTTGTGCAGCAGAGACGCTAAACACATTTAAATTTGCTCAGAGAGCAAAGCTAATCCAGAATAATG
CTGTGGTCAACGAAGATTTCAATGGGGATGTCCTGGAATTACGCCGTCAAATCCGACTTCTCAAGGAAGAGCTTTCCCTC
CTCAAGCGCCAGAACATCTCCAGGGCATTGTCATTCGGAACAGCAACAGCCAACATTACAGAATTCCAAGTCGATTCTCC
ATCGAATGAATTGCCGGAGAGAGGACATCAACAGGCTAGAAACTCACTCGTGTATGAATCTGGAGGCTGTGTAAGGATGT
CTAGAAAGCAGTTGAAATCGTTGGAGATAACACTCGCTGGCTCATTGAGAAGAGAACATGTGGCTGATGCTTCTATTAAG
AATCTTGAAGCTGAGATCGAGCACTTAAACCGTTTGGTTCGGCAAAGAGAGGAAGATACTAGGAGCACAAAAATGATGCT
CAGGTTTCGAGAAGACAAGATACAGAGGCTAGAATCACTTCTTGGCAACCATATATCTGCAGATTCTTATTTGTTGGAAG
AGAAGAATGTGCTGTCAGAAGAGATTCAGTTGCTTCAAGCTAAAATTGACAAAAATCCTGAATTGACTCGCTTTGCCCTG
GAAAACATAAGGCTTCTGGACCAGCTTAGAAGATTTCAAGAGTTCTATGAGGAAGGTGAGAGAGAAATTCTACAAGGAGA
AGTCTCGAATCTGAGAAACCAGCTTGTCCAGTTTCTTGATGAAAACGCTGACCGGCAAAAACATCCTGATGATGTAACAG
AGCCACAGGATGCACTACGTATTAGCAAAGAAAATTATTCACTACAGGAGGAGCTAAAAAAGACCTCTAACGAGCTTGAA
AAATGCCGAAGTAAACTTGGTTCTTGCCTGGAAGAGAATGCAAAGCTTAGTAGGGAAATCCATGATCTTCAGGCTATGGT
CAGCGATATCAGAGCTTCCACACCTGATGAACATAGTTCGAACAAACAAAAGGCCCTGCTGGAAACTCAAAATGCTGATC
GGCCCGAAACACTTGCTGGTCAGCAGGTCAACCATGTCGAAGAAATCATCAAACTACAGCTTGATTTGGATGTACTGAAA
ATTATACTCGATGAGGAAAGAACACTACGTGGTGATACAGAGGCACAGGCAGTTCTCTTGAAACTTAATATTGGAGAGTT
GAAGGACCAACTACTCCTGATGAGCAAGCAGCAAGAAAATGTAAACAGTGAGCTGCGCGAGACAAAGTCTGTAGTTGAAG
CTCTCGAGTCGCAAAACAGTATATTGATCCAAGAAGCTGTTGAGTTGAGGAGAACAAAGGAGAAGTATACTGAACTTTTA
CAAAAGCAAGAGCTTGACATCCCAGCAACTAAGTCCAAACAGTGCAATGAGTTCAAAGATAATCCTGCAGAGGACAATGC
AATTAATGCCAAGTTCAAGAAAATGCAAGCGTCTCTTGAAAAAGCTAAGAGGTTGAACATGTTGTTCAAGAATGATATTG
CTTCTAAGGCATGTGGAGATGAAGAAACGGACGAAGTTCAAAGACAAGCCGAAGCGGAAACTGCTGAGGTGATTGTCTAT
TTGCAGAACGAGCTCGAAGTTCTTCAGAAGGAGGTTGATGATTTCCAATCAAAAGAAAACGTGACTGAACAGCAAGTAAA
GCTTTTGGAAACTCATATGGAGGAGCTGCAGGATAACTTGCGAGATATGACCATGGATAATGAGCAGTTGCAAGAAAATC
TCAGAAGCAAAGAAATGGAGCTACAGATCATTTCAAACGAGATGGAACTTCTGACATCTGAGCTTGAAGAAATTTTGCTG
AGTGGGAATGAAGGCCTTACAGATGCATGTTACCAAGCTGATCTAATTTCGGATTCCTTTCCAGATAAAAGGATATGGAT
ATCTGAACAGGTTGGGGAGCTAATAAGAACAATTTCTGAGAGGGAATCAGTGATCGAAGATCTTGAAAGCTGTTTAGAGG
ATGCCAATAAAAAGCAGTGTGATATAGAATCCATGTTGAAGTCTCTTAGAGGGGCAGCATTAGTGATGAGTGAAGCGCAC
CAGAGAGAGTACGAGGAAAAGGAGACACATACTCTCCTCTTGAAGTCGCAGTTGTGCAAGAAAGCAGAGGCCATGTCAAG
GCTTCTAGAGAAGCTGAAGATGGCTGAAAGTTGGATTTATGAAGCATCACACTGTGCAACAGCTTCTCTAGTAATCGTTA
ACCGATATTCTGAGATAATCGAATCACATACTTTTGAGTTGAAGCAAAAGGATCTCCAGCTTGAGGAATCTGCTGGAACA
GTTCTTTCTCTGAACCAACAAGTACAAGATTTGGAAGCAACCTGTGAAGAATTCAGAAGCAAGCTTCTGGAAGAAGCAAA
GAATGCTTCTGCTATGGAACGAAAGCTTGAAGAAATTGAGGAGACTGGCATTTCAGCCATGAAGGAGAAGCTTTCTGAGC
TCAAGGGTGGCGTATCTGGACTGAGATCATGCATAAATATGTGTCAAGAACATGAAAAGTACACTGAGGCAGAGAAATCA
CTAGGGTCTCCAGCCCACTGTAGTGAAGAACAGGAAAATGGAAGGAATGTAGTTGTCTCGTCTTGCATTGAGAAGACTCC
AACCAAAAATCATTCGGAGCCCATGAGAGCTAGCAGTCAGGTGTCTACTGAGAGAGGTAAAGTGATTATACTGCTAAAGC
AAGAAATGGAATCTGCTCTTGTAAGCTTGAAGGAGGTTCAATTTGAGATGGCCAGACTCCAGGAGGAGAAGGAAGAGCTA
AAGGCGTCTGAGAAAAGAAGCTTAAGCAACTTGCACGATCTTGCTGCACAGTTCTCCAACCTTGAGACTGTGATGAATAG
GATGAAAGAACAAAATGAGAACAAAATGGAAGCCACAGATCATAAACTTGAAACTTTGGAGCATGAACTTGCTAAGATGA
AGCTAGAGGCTGGCCAGGGACATGTAGAAAACTTATGTGTTCTTCAGAAATTTGAGGAGGCTCAATGGACTATTAAAGAA
GCAGATATCATGATCAATGAGCTCATAATAGCGAAAGAAATGATGAAACTTGACCTGGAGAAACAGAAGAAAAAGGAAAG
AAGCTTGGTTGGAGAGAGAAACGCCTTAGTTGACAAACTGCAGGAGCTGGAATCCATAAATGTCAAAGAAAATGAAAAGG
TTGAGTACCTTGAGAAGCTATTCGAGTCAAGTTTGATGGGTGTAGGAGATCTTGTCGAAGAGCTGGAAACTGTTGTCAGA
AAACTACAAGACGAATCATCTGAGGCCTTGACTGGCATGGCCAATGATTTATCTGACTTGAAGTCTTCGGTTTCAGAAAC
AAAGTCAGCTAGGTTGTTCCTCGAGGATATCTGGTCAGAAATAATCATGAAGGATTGTGCTCTCTCAGTTCTACATCTAT
GCCATATGGGGGTTTTGCTTGAAACAGTTACAGGGGTCAACGCCGAAAATGGTCTGCTTCATCGTGGTCTGTGTGAATCA
AACTCTTCCATAGCCGGATTAAGAGATAACAATGTCAGGTTAAGAAGGGAGCTTGAGATGTTTACAACGCTCAAGGGTAA
ACTGCTAGCTGATATAAAGAATGGTTTTGAGAGAGTTTCAAGAAATGAAGAAGCAACTAATCTGCTCACTACAAAATTAA
GCAATTTTGAGCAGAAAATTTCAGGTTTACAGTACCAGGAGGAGCTGATGTTGCAAAGATCTGACAGCATGGGGTCTCAG
CTTGATATTTTGATGAAAGAAATAGATTTGAGCAATGGGAACCTTGCAGAAACTCTGTTGGAGCAAAAGCTGCATCTGAA
TCAGAAAAGTGATTTCTTTGACACTGAAGTTCAACATTATTTGATGGATCTCTGCTCAAAGGATGTTGAGTCACTTGTTC
TGGCGCTAAAAGTAAAAGAATGTTCTTCTTGTCTCGCAATTCTGGACAAAGAGCTTCTTGATCATCAGGCCTTCGTTGAG
GATCTCAAAGAGAAATTGTTTGTTTCCCAGGTGGAGAGTGAGCTCAAAGACCTCTGTCTGGTTGATAACAAATTGGAGAC
CGTTTCAGATAAACAAAAGCTGACTGAAGCACAAAGAAAGATCAAGGTTCTCTCGTCAGATCTTAAACACAGTGTGCAAA
AAACCGTCGAAATGGATGAGGCAAACAAGGCTTTTGGAGAAAGAGTCTTCTTCTTGGAGTCTCGCGTTTCTGACCTACAG
CAAGATTTAGAGAGGAAAGATTTTGAACTTCAGAGTCTCCAACATTCACAGTCGATTGCTGCAGGAGAACTGGGTATCAA
AGAAAGGGATATACAAGTTTATGCTGATGCTGTCAGTGCGTTGAAGAATGAAAACAGCTCTCTTAAGCACACGTTTATGC
ATTTTGGTGAAGATCAGTCTAAAGCATTAAATGTCAACAGCATAAGCATTGCCAAATGTTCTGAAGGTAGCAGAACACTG
GAGAAACTAACCAGGGATGGTCTGGTATTCTCTGATCAAATGTTCGAACTGATGTGTGAAAACGCCAATAAGGCTTCGGA
ATTCGCAGATACTGTTCAGTCTTTGCAGATTGATGTAGAAGACTTGCTGTCTGAAAATCTGAATCTCCAGGATGAGCTTT
TGCGAAAGGATGATGTTCTGAAGGGGTTGTCTTTTGACCTCAGCCTACTACAAGAATCTGCTTCCAATTCCAGGGACAAG
GAAGATGAAACAAAGGAAATCATGGTTCATGTTGAAGCTTTGGAAAAGACACTAGCTTCGAGAACCTCTGAACTAGAAGA
GGCTGTTTCTTTCGCCCAAATGCTTGAAGTCCAGCTGCAAGGGAGCAAAGAAATTATCTGCAACCTTGAAAAGGATACTG
AAAAGGCAATGCAGTGCCGAGAGCAGCTGGCAGCAGAAAATGAAGAAATTAGAGCAGAAGCTGAAGATCTCTTGGCAGAG
AAAAGCTCTCTAGAGGAGGAGCTGATCCAGACAAAAAAGGTATCTGAGAGCATGGAGATGGAGCTCTTTAATCTAAGAAA
TGCTCTCGGACAACTGAATGATAAAGTTGAGTCTACCCAGAGCAAATTAGATGAGACCATCGATGAGAGGGATAATCTAC
AAGATGAGGTTTTGTATGTGACAGAAGAACGTGGGAAAATGAAAGCTGAGGCTAAAGAATTGGAAGTTAGAATCATAGAA
GCTCAAGAGATTGCTGAGTCAAGAAAGATGTATGCCGATCAGAGAGAAGAAGAAGTGAAGCTACTAGAGGGATCAGTTGA
GCAGCTTGAGTATACTATCGATGCACTTGAAAATAAGGTTAACGTTATCAAAGATGAAGCTGAAAGACAGCGTCTGCAAA
GGGAAGAGCTGGAGACAGAGCTTCACACCATACGCCAGCAGATGGAAAGTGTTAGAAATGCTGATGAGGAAATGAAGAGA
ATTTTAGATGAAAAGCATATGGATCTTCAAGAAGCTCAGAAGCATATAGAAGCGCTTGAGAGAAAGACGGCTAATCAAAT
GACTGAGATTACTCAACTCAGCGCGCATATCTCAGAATTAAATATGCATGCAGAGGCGCAGGCTAGAGAATACATGCATA
AGGTTAAGGAACTGGAGGCAATGGCTGAGCAAGTAAAACCAGAAATTCATGTTTCTCAAGCTGTGGACTCTTCATTGAGT
AAAGGTTCTGGGAAGCCTCGGGGTTCTGGCTCTCCTTTTAGGTGCATAGGGTTGGGACTTGCCCAACAAATGAGGTCTGA
GAAGGATGAGGAGCTTGCTGCTGCTAGGCAACGAGTTGAAGATCTTGAAACTGTAGTTGCAACCAAGCAGAAAGAGATAT
TTTTACTGAACTCAAAACTCGCCAAGGTGGATAGCATGACCCATGATATTACTAGAGTTATGCTCGGACTCAAACAGAAT
TGCGCATCATTATTGGATAGTCAGCAAGTATCAAAGATAGCAGAGATGCTTCAACGTTATAGTTCAGATTCACGAGAAAC
GGATTTTGAAGTCTCTCAGCTCAAGCGGCAACTCAGTGAATATAATGAGGAAAGGCAAGGATGGCTAGAGGAGATTGAAG
GAAAGCAAAGTGATTTAGTTACTGCACAGATAGAACTGGAGGAACATCGACAGCATGAGCAACTGCTCAAGAAAGAAAAC
GAATTCCTGAAGGAAGAAAACAATGTGTTGAAACTTCAGCTTGATGAGCTCAATCTAAAGTTACGAAGAGCAGATGTGAA
TATTTCTCGTGCTAAAGAAGAGCTTGCTTGGTACCGAGCATCTACAGGAAAGAACCAACATTCAAACTTTGAAAAGATGC
ATCATTTAAGTACCAAACTGAAGGAAAGCGAAGAGGAAAGAATGCAGCTGGGTAAGCAGCTATTATGTCTCTCCACCAGT
ATCTTAAAGGCAGCAGGTGTAACAGGAGAAGATATCACAGACATAAACCCTGAAGTTGCTGAAGAGGCACTTGAACAGCT
CAAGACAAGAGTTGGTTTACTTGAAAGTGAATTGGATCACTTTAGATTAAAGGGAAAAACAAAGAGCAGAAGAAGTAGAA
ATCCTGAGAGGGCGATGCCTTCAATGCCTTCGCCTAGAAGAAAATCATGGAGTCAGAGTCCAAGAAAGATGTCTCAGGTT
CCTTTTTTCACTTCTGTAGACAGGTGA