Details for Kale Locus Bo5g115600

Position : C5 ( 5`- 35528617 .. 35531133 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115600

Protein [Map View]
MAQMHREDVESVTADKKVSDGGGGGGGGGSSGTQASSFKFNAEAPEFVPQSRAAVPTPQVSPISGYFYPCFHYSDGGGTA
VGSQASDWFFVGGGDPAQHPHVHDPAAAFYVPSPAVQFPVNQNSSPSSSLLSDDLRLKIVKQVEYQFTDMSLLANESISK
HMNKDPEGYVPISYIASTKKIKALTSNHHLVSLALRSSSKLVVSEDNKKVKRKVPFTDRDREDLQGRTVVAENLPDDHSY
QNLEKIFGVVGNVKAIRICHPPESNSSRPKGDFLMSNKIHALIEYDHTVVADKAVEKLNDERNWRKGLRVRLLLRCSPKS
VLKHRRNFDGILIDDESPYESGEDSPRLHLTEHQLDNEGDENTLGGLWGKGRGKGRGRSPRSYVVGGGERSFGIGMGLSL
GPMSPSLGLHGSSSPKTATKGPRMPDGTRGFTMGRGKPVNLSLI*

DNA
ATGGCGCAGATGCACCGAGAAGATGTTGAATCCGTCACGGCGGATAAGAAAGTCTCAGACGGAGGAGGAGGAGGAGGAGG
CGGCGGATCTTCCGGCACTCAGGCGTCCTCGTTCAAATTCAACGCTGAAGCACCAGAGTTCGTACCACAATCGCGTGCCG
CCGTACCTACACCGCAGGTTTCTCCGATCTCCGGTTACTTTTATCCTTGCTTTCACTACAGCGACGGAGGAGGGACGGCG
GTCGGTTCTCAGGCGTCGGATTGGTTCTTCGTCGGAGGAGGAGATCCTGCTCAGCATCCACACGTTCACGATCCGGCGGC
TGCGTTTTACGTTCCGAGCCCGGCGGTTCAGTTTCCGGTGAATCAGAACTCTTCTCCTTCTTCTTCGTTGCTCTCTGATG
ATCTCCGCCTTAAGATCGTCAAACAGGTTGAGTACCAGTTCACGGATATGAGTCTCTTAGCTAATGAGTCCATCTCAAAG
CACATGAACAAAGACCCTGAAGGTTATGTGCCAATATCTTACATTGCTTCCACCAAGAAGATCAAGGCTTTAACGAGTAA
CCACCACTTAGTTTCATTGGCTCTGCGCTCCTCCTCTAAGCTTGTTGTGAGTGAAGACAACAAGAAAGTTAAGCGTAAAG
TTCCATTTACTGATAGAGACAGAGAGGATTTGCAGGGCCGGACCGTTGTTGCAGAGAATCTACCAGATGATCACTCCTAC
CAGAACCTTGAGAAGATCTTTGGAGTTGTTGGAAACGTTAAAGCGATTAGAATCTGTCATCCTCCAGAATCAAACTCCTC
TCGTCCAAAAGGAGATTTCTTGATGAGCAACAAAATTCACGCACTGATCGAGTATGACCACACTGTTGTCGCGGACAAAG
CTGTGGAGAAGCTGAACGATGAAAGAAACTGGAGGAAAGGACTTCGTGTGAGGCTGCTTCTTAGATGCTCGCCCAAATCA
GTTCTCAAGCACAGAAGAAACTTTGATGGCATCCTCATAGATGATGAGAGTCCTTATGAATCAGGAGAAGACTCTCCACG
TCTCCATTTAACCGAGCATCAGCTTGATAACGAGGGTGATGAGAACACTCTTGGAGGACTGTGGGGAAAAGGGAGAGGAA
AAGGAAGAGGACGGTCTCCAAGAAGCTATGTGGTAGGAGGAGGAGAACGTAGCTTCGGTATTGGGATGGGACTCAGCCTT
GGCCCAATGTCACCGAGTCTAGGTTTACACGGATCTTCGTCTCCAAAAACAGCAACAAAAGGACCAAGGATGCCTGATGG
AACAAGAGGCTTCACCATGGGACGTGGCAAACCTGTCAATCTCAGTCTTATCTAA