Details for Kale Locus Bo5g115580

Position : C5 ( 5`- 35515945 .. 35518336 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115580

Protein [Map View]
MQTTNGSDSTSATPPANQTTPPPPQQWQQHQQWMMQYPGAAAMMMMQQQQQHMMMYPHQYLPYNHGGHYHHHPPNLQYAP
YHQQHHNHHQKTHERGGSGEDVKTLWVGDLLHWMDETYLHTCFSHTGEVSSVKVIRNKQTLQSEGYGFVEFLTRAAAEEV
LQSFSGSIMPNSEQAFRLNWASFSTGEKRAVENGPELSIFVGDLSPDVTDSMLQELFAERYPSVKSAKVVIDSNTGRSKG
YGFVRFGDESERSRALTEMNGALCSNRQMRVGVATPKRAVANQQQHSSQAVIVAGGHGANGFTAHGSQSDGDSNNSTIFV
GGLDPDVTEEDLREPFIQFGEVVSVKIPLGKGCGFVQLSNRKSADDAIQSLNGTVIGKNTVRLSWGRTPNKQWRGDNGGY
SRGQGYNNGGYANHHDSNTYPAET*

DNA
ATGCAGACAACCAACGGCTCAGATTCGACGTCAGCCACGCCTCCGGCTAACCAAACGACTCCTCCGCCGCCTCAGCAGTG
GCAGCAGCATCAACAGTGGATGATGCAGTATCCAGGCGCGGCGGCGATGATGATGATGCAACAGCAGCAGCAGCATATGA
TGATGTATCCTCACCAATACCTTCCTTACAATCACGGTGGTCATTATCACCACCACCCTCCTAACCTCCAATACGCACCG
TATCATCAGCAACACCATAACCACCACCAAAAGACACATGAGCGTGGTGGATCTGGAGAAGACGTCAAGACTCTATGGGT
TGGTGACCTTCTTCATTGGATGGACGAGACTTATCTCCACACCTGCTTTTCTCACACCGGCGAGGTTTCTTCTGTGAAAG
TTATTCGAAACAAGCAGACACTTCAGTCAGAAGGATACGGTTTTGTTGAGTTTCTTACACGTGCTGCAGCTGAAGAGGTT
CTTCAGAGCTTTAGCGGTTCTATAATGCCTAACTCCGAGCAAGCCTTCCGCTTAAACTGGGCGTCTTTTAGCACTGGTGA
GAAGAGAGCAGTAGAGAATGGTCCTGAGCTGTCGATATTCGTTGGAGATTTGTCTCCGGATGTGACTGATAGTATGTTGC
AAGAGTTGTTTGCTGAGAGATATCCCTCTGTCAAAAGCGCTAAAGTTGTGATTGACTCCAACACCGGCCGGTCTAAAGGT
TACGGTTTTGTTAGGTTCGGTGATGAGAGTGAGAGATCAAGGGCTTTGACTGAGATGAATGGAGCTTTGTGTTCCAACAG
GCAGATGAGAGTTGGTGTTGCGACTCCTAAAAGAGCTGTTGCTAATCAGCAACAACATTCTTCACAAGCTGTGATAGTGG
CTGGTGGACATGGAGCAAATGGTTTCACTGCTCATGGGTCACAGTCTGATGGTGATTCAAACAACTCAACAATATTCGTT
GGCGGACTTGACCCTGATGTTACTGAAGAAGACCTCAGAGAACCTTTTATACAATTTGGCGAGGTTGTTTCAGTGAAGAT
CCCACTAGGCAAAGGATGTGGGTTTGTCCAACTTTCTAACAGGAAGAGTGCTGATGATGCGATCCAGAGTTTGAACGGGA
CAGTCATCGGCAAGAACACTGTCAGGCTCTCTTGGGGAAGAACTCCGAACAAGCAGTGGAGAGGAGACAATGGAGGATAC
TCGCGAGGACAAGGTTACAACAACGGAGGCTACGCTAACCACCACGACTCCAACACCTATCCTGCCGAGACTTGA