Details for Kale Locus Bo5g115560

Position : C5 ( 5`- 35497073 .. 35497872 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115560

Protein [Map View]
MSERNLNSKRESRELEASSTSVSPLQKKKKLDDSSADSHAVVLAIPSPSVASTQGRYSVTSDDDDKSSIVSSGCFSSESN
ETVRNNPSSGVDLEDTVSEALGETTETEMESSSPALKRDNKPPGVSKIPTAEEVEAFLSELEGGEDKQKRFIEKYNFDIV
NDKPLQGRYMWDRLKP*

DNA
ATGAGCGAGAGAAATCTCAACAGCAAACGAGAATCGCGAGAGCTTGAAGCTTCAAGCACAAGCGTCTCCCCACTCCAGAA
GAAGAAGAAGCTCGATGATTCTTCAGCCGACTCTCATGCCGTCGTCCTCGCGATTCCCTCTCCTTCCGTAGCTTCAACGC
AAGGTAGATACTCTGTCACCTCTGACGACGATGATAAAAGCTCTATCGTCAGCTCCGGCTGTTTCAGCAGTGAATCGAAC
GAAACCGTGAGGAACAATCCATCCTCTGGTGTAGATCTGGAGGATACAGTGAGCGAGGCTTTGGGAGAAACAACAGAGAC
GGAAATGGAATCATCATCGCCGGCGTTAAAGAGGGATAATAAACCACCGGGAGTGAGCAAGATTCCGACGGCTGAGGAGG
TCGAAGCATTCTTATCGGAGCTAGAAGGCGGCGAGGATAAACAAAAGCGATTCATAGAAAAGTACAACTTCGATATCGTC
AATGACAAACCGCTTCAAGGTCGTTACATGTGGGATCGACTCAAGCCATGA