Details for Kale Locus Bo5g115530

Position : C5 ( 5`- 35483851 .. 35488150 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115530

Protein [Map View]
MPVLYTFPLLPSSSSLLHGISNRGTSIILHPPEVQISCFLVARSDPGEFDGFSCSLRRRRLNAGGAHVFDNAPSRTSSLA
ASTSTIEIPVTCYQLIGVSEKAEKDEVVKSVLNLKKTDAEEGYTMEAAAARQDLLMDVRDKLLFEPEYAGNLKENISPKS
PLRIPWAWLPAALCLLQEVGEEKLVLDIGRSVLRHLDSKPYIHDIFLAMALSECAVAKDAFEANKVSQGFEALARAQSFL
KSKVTLGKLALLSQIEESLEELAAPCTLDLLGLPPLPENAERRRGAVAALRELLRQGLDVEASCQIQDWPCFLSQAISRL
LATEIVDLLPWDTLAITRKNKKSLESHNQRVVIDFNCFYMVLVAHIAVGFSVKQTDKINKAKSICECLIASEGVDLKFEE
AFCSFLLNQGSEAETLEKLKQLDSNSDSAVRNSILGKELRTTSATPSLEAWLKDSVLANFPDTRGCSPSLANFFRAEKKY
PENKKMGSLPIINHKTNQRPISSMQFMNSSQHLYTSVEQLAPTNLQSPVASTKNIDESGASRPSVQLKRNLGLQQNKIWN
GWLSQSSLIQRISVTALLGCTVFFSLKLTGIRSARFQSLPTWGSAKPHLESDSGNFRRNLASVNREGVVGNIKTLLDMLK
RHHGEHSDALYLKSSGLSATLSHPTSEVHKRPMLTEDAEELVRQWENIKAEALGPTHQVYSLPEVLDEAMLVQWQTLAQT
AKAKSCYWRFVLLNLEILQAHISTDGSIAGETAEIEALLEEAAELVDESQPKNAKYYSTYKIRYTLKKQEDGSWRFCQSD
IQIQK*

DNA
ATGCCAGTGCTCTACACGTTTCCACTTCTCCCTTCTTCTTCTTCTCTGCTCCACGGAATCTCCAATCGCGGCACCAGCAT
CATCCTACATCCCCCGGAGGTTCAGATCTCATGTTTTCTCGTCGCGCGTTCTGATCCCGGAGAATTCGACGGTTTTAGTT
GCTCTTTGCGGCGGAGGAGGTTGAATGCTGGTGGTGCACATGTCTTCGATAATGCTCCGTCTCGTACCTCTTCGCTCGCT
GCATCTACATCCACAATCGAGATCCCGGTTACGTGTTACCAGCTTATCGGAGTTTCTGAAAAAGCTGAGAAAGACGAGGT
CGTTAAGTCGGTGTTGAATTTGAAAAAGACTGATGCTGAAGAGGGCTATACAATGGAAGCTGCTGCAGCTCGCCAGGATC
TTCTCATGGATGTTAGGGATAAACTTCTCTTTGAACCAGAGTATGCTGGTAACCTTAAAGAAAATATTTCTCCTAAATCT
CCTCTTAGAATCCCATGGGCTTGGTTGCCTGCTGCTCTCTGCCTTCTTCAAGAGGTTGGAGAAGAAAAACTTGTGCTGGA
TATTGGCCGGTCTGTTCTCAGGCACCTTGATTCAAAGCCATATATTCATGATATATTTTTGGCTATGGCACTTTCTGAGT
GCGCGGTCGCCAAGGATGCTTTCGAGGCGAACAAAGTCTCTCAAGGATTTGAAGCTCTTGCTCGTGCTCAGTCTTTTCTG
AAGAGTAAAGTTACTCTTGGGAAACTTGCATTGTTATCTCAGATAGAAGAGTCCTTGGAGGAGCTTGCAGCACCATGCAC
ATTAGATCTACTGGGCCTACCTCCCTTGCCGGAAAATGCGGAGAGGAGACGAGGTGCAGTTGCAGCGCTACGTGAACTTC
TGAGACAAGGCCTTGATGTTGAAGCTTCCTGTCAAATTCAAGACTGGCCATGCTTTTTGAGCCAGGCAATTAGCAGGCTA
CTGGCCACAGAGATTGTTGATCTCCTTCCATGGGATACCTTGGCCATTACACGGAAAAATAAAAAATCACTTGAATCCCA
CAATCAAAGAGTAGTAATTGATTTTAATTGTTTCTACATGGTGTTGGTTGCTCATATCGCTGTTGGATTTTCAGTCAAGC
AAACTGATAAGATTAATAAAGCAAAATCTATATGCGAATGTCTAATAGCATCAGAAGGTGTTGATCTGAAATTTGAGGAA
GCTTTTTGCTCATTTCTTCTAAACCAGGGTTCCGAGGCTGAGACCCTTGAAAAACTTAAGCAGCTGGATTCAAATTCAGA
CTCTGCGGTTCGTAATTCGATCTTGGGGAAAGAGTTGAGAACTACTTCTGCAACACCATCGTTGGAAGCGTGGCTAAAGG
ATTCAGTGCTTGCCAACTTTCCAGACACAAGGGGTTGTTCGCCATCTTTGGCCAACTTTTTCCGGGCTGAAAAAAAATAT
CCAGAGAACAAGAAAATGGGGTCACTGCCAATTATTAATCACAAGACGAACCAAAGACCGATTTCCTCTATGCAGTTCAT
GAACTCGTCACAACATCTTTATACATCTGTCGAGCAATTGGCACCAACAAATCTGCAGAGCCCAGTAGCATCAACAAAGA
ATATTGATGAAAGCGGTGCCAGTAGGCCATCGGTTCAACTGAAAAGGAACCTTGGTTTACAGCAAAATAAAATATGGAAT
GGTTGGCTCTCTCAGAGCAGTTTGATCCAAAGGATATCTGTTACTGCTTTATTAGGCTGCACCGTGTTCTTCTCTCTAAA
GCTAACAGGCATTAGGTCTGCTAGATTTCAGAGCCTGCCTACATGGGGTTCTGCAAAGCCGCACTTGGAATCAGATTCTG
GGAATTTCAGAAGAAACCTTGCTTCGGTGAACAGAGAGGGTGTCGTGGGCAACATCAAAACACTCTTGGACATGTTGAAG
AGGCATCATGGGGAACATTCGGATGCCTTGTATCTAAAAAGCTCTGGTCTATCGGCTACATTGTCTCATCCCACCTCGGA
AGTTCACAAAAGACCTATGCTTACAGAAGACGCCGAAGAGCTTGTGAGACAGTGGGAAAATATTAAAGCTGAAGCTCTTG
GACCTACACATCAAGTTTATAGCCTTCCTGAAGTCCTTGACGAAGCCATGCTTGTCCAGTGGCAAACGTTGGCGCAAACA
GCAAAAGCTAAATCTTGTTATTGGAGATTCGTTTTGCTTAATCTTGAGATTTTGCAAGCACACATATCGACAGATGGTAG
TATTGCTGGTGAGACGGCCGAAATCGAGGCCCTTCTAGAGGAAGCAGCAGAACTAGTTGACGAGTCTCAGCCCAAAAACG
CAAAATATTACAGCACTTACAAGATCCGCTATACTCTGAAGAAGCAAGAAGATGGATCGTGGAGATTCTGCCAAAGCGAT
ATCCAAATACAGAAATGA